BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50039712 CC1C2Cc3ccc(O)cc3C1(C)CCN2Cc1ccccc1 |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C21H25NO/c1-15-20-12-17-8-9-18(23)13-19(17)21(15,2)10-11-22(20)14-16-6-4-3-5-7-16/h3-9,13,15,20,23H,10-12,14H2,1-2H3 RPMPAQXGZYLEST-UHFFFAOYSA-N 50032410 3-Benzyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::CHEMBL318877 Sigma non-opioid intracellular receptor 1 Homo sapiens 0.670000 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032410 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032410&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90748 103940939 CHEMBL318877 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50039713 [#6]-[#6]1-[#6]-2-[#6]-c3ccc(F)cc3C1([#6])[#6]-[#6]-[#7]-2-[#6]\[#6]=[#6](/[#6])-[#6] |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C19H3FN/c1-13(2)7-9-21-10-8-19(4)14(3)18(21)11-15-5-6-16(20)12-17(15)19/h5-6,12H YBLJVWMBCZWVFL-UHFFFAOYSA-N 50032409 8-Fluoro-6,11-dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL103157 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 51.8 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032409 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032409&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10085466 103940938 CHEMBL103157 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50039714 CC1C2Cc3ccccc3C1(C)CCN2Cc1ccccc1 |TLB:15:14:1:9.3.4,8:9:1:14.12.13| InChI=1S/C21H25N/c1-16-20-14-18-10-6-7-11-19(18)21(16,2)12-13-22(20)15-17-8-4-3-5-9-17/h3-11,16,20H,12-15H2,1-2H3 QAAXWTHVNTVMCJ-UHFFFAOYSA-N 50032405 3-Benzyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL101607 Sigma non-opioid intracellular receptor 1 Homo sapiens 18.4 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032405 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032405&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767676 103940934 CHEMBL101607 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50039715 CC1C2Cc3ccc(Cl)cc3C1(C)CCN2Cc1ccccc1 |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C21H24ClN/c1-15-20-12-17-8-9-18(22)13-19(17)21(15,2)10-11-23(20)14-16-6-4-3-5-7-16/h3-9,13,15,20H,10-12,14H2,1-2H3 SFRKZPDHORQPCB-UHFFFAOYSA-N 50032415 3-Benzyl-8-chloro-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL276078 Sigma non-opioid intracellular receptor 1 Homo sapiens 40 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032415 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032415&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767682 103940944 CHEMBL276078 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50039716 CC1C2Cc3ccc(Cl)cc3C1(C)CCN2Cc1ccccc1 |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C21H24ClN/c1-15-20-12-17-8-9-18(22)13-19(17)21(15,2)10-11-23(20)14-16-6-4-3-5-7-16/h3-9,13,15,20H,10-12,14H2,1-2H3 SFRKZPDHORQPCB-UHFFFAOYSA-N 50032415 3-Benzyl-8-chloro-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL276078 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 381 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032415 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032415&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767682 103940944 CHEMBL276078 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50039717 [#6]-[#6@@H]1-[#6@H]-2-[#6]-c3ccc(-[#8])cc3[C@]1([#6])[#6]-[#6]-[#7]-2-[#6]\[#6]=[#6](/[#6])-[#6] |r,TLB:16:15:1:10.4.3| InChI=1S/C19H5NO/c1-13(2)7-9-20-10-8-19(4)14(3)18(20)11-15-5-6-16(21)12-17(15)19/h5-6,12,14,18H NTESFUMRHWXLJE-UHFFFAOYSA-N 50407300 CHEMBL397705 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 37 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50407300 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50407300&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 9669 163356324 CHEMBL397705 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50039718 [#6]-[#6]1-[#6]-2-[#6]-c3ccccc3C1([#6])[#6]-[#6]-[#7]-2-[#6]\[#6]=[#6](\[#6])-[#6] |TLB:15:14:1:9.3.4,8:9:1:14.12.13| InChI=1S/C19H4N/c1-14(2)9-11-20-12-10-19(4)15(3)18(20)13-16-7-5-6-8-17(16)19/h5-8H FONCFTOYRBTYTR-UHFFFAOYSA-N 50032404 6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL330601 Sigma non-opioid intracellular receptor 1 Homo sapiens 1.6 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032404 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032404&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767674 103940933 CHEMBL330601 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50039719 CC1C2Cc3ccc(O)cc3C1(C)CCN2Cc1ccccc1 |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C21H25NO/c1-15-20-12-17-8-9-18(23)13-19(17)21(15,2)10-11-22(20)14-16-6-4-3-5-7-16/h3-9,13,15,20,23H,10-12,14H2,1-2H3 RPMPAQXGZYLEST-UHFFFAOYSA-N 50032410 3-Benzyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::CHEMBL318877 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 1710 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032410 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032410&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90748 103940939 CHEMBL318877 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50039720 CC1C2Cc3ccc(F)cc3C1(C)CCN2Cc1ccccc1 |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C21H24FN/c1-15-20-12-17-8-9-18(22)13-19(17)21(15,2)10-11-23(20)14-16-6-4-3-5-7-16/h3-9,13,15,20H,10-12,14H2,1-2H3 GMSWWAYLXZJZCL-UHFFFAOYSA-N 50032401 3-Benzyl-8-fluoro-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL101300 Sigma non-opioid intracellular receptor 1 Homo sapiens 20 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032401 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032401&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767681 103940930 CHEMBL101300 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50039721 CC1C2Cc3ccccc3C1(C)CCN2Cc1ccccc1 |TLB:15:14:1:9.3.4,8:9:1:14.12.13| InChI=1S/C21H25N/c1-16-20-14-18-10-6-7-11-19(18)21(16,2)12-13-22(20)15-17-8-4-3-5-9-17/h3-11,16,20H,12-15H2,1-2H3 QAAXWTHVNTVMCJ-UHFFFAOYSA-N 50032405 3-Benzyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL101607 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 487 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032405 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032405&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767676 103940934 CHEMBL101607 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50039722 CC1C2Cc3ccc(F)cc3C1(C)CCN2Cc1ccccc1 |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C21H24FN/c1-15-20-12-17-8-9-18(22)13-19(17)21(15,2)10-11-23(20)14-16-6-4-3-5-7-16/h3-9,13,15,20H,10-12,14H2,1-2H3 GMSWWAYLXZJZCL-UHFFFAOYSA-N 50032401 3-Benzyl-8-fluoro-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL101300 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 43 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032401 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032401&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767681 103940930 CHEMBL101300 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50039723 [#6]-[#6]1-[#6]-2-[#6]-c3ccc(F)cc3C1([#6])[#6]-[#6]-[#7]-2-[#6]\[#6]=[#6](/[#6])-[#6] |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C19H3FN/c1-13(2)7-9-21-10-8-19(4)14(3)18(21)11-15-5-6-16(20)12-17(15)19/h5-6,12H YBLJVWMBCZWVFL-UHFFFAOYSA-N 50032409 8-Fluoro-6,11-dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL103157 Sigma non-opioid intracellular receptor 1 Homo sapiens 31 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032409 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032409&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10085466 103940938 CHEMBL103157 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50772405 CC1C2Cc3ccc(F)cc3C1(C)CCN2Cc1ccccc1 |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C21H24FN/c1-15-20-12-17-8-9-18(22)13-19(17)21(15,2)10-11-23(20)14-16-6-4-3-5-7-16/h3-9,13,15,20H,10-12,14H2,1-2H3 GMSWWAYLXZJZCL-UHFFFAOYSA-N 50032401 3-Benzyl-8-fluoro-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL101300 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 43.0 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032401 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032401&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767681 103940930 CHEMBL101300 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50772406 CC1C2Cc3ccccc3C1(C)CCN2CC=C |TLB:15:14:1:9.3.4,8:9:1:14.12.13| InChI=1S/C17H23N/c1-4-10-18-11-9-17(3)13(2)16(18)12-14-7-5-6-8-15(14)17/h4-8,13,16H,1,9-12H2,2-3H3 DCDPEUIZVWTSCT-UHFFFAOYSA-N 50032402 3-Allyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL318823 Sigma non-opioid intracellular receptor 1 Homo sapiens 83 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032402 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032402&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767675 103940931 CHEMBL318823 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50772407 [#6]-[#6@@H]1-[#6@@H]-2-[#6]-c3ccc(-[#8])cc3[C@@]1([#6])[#6]-[#6]-[#7]-2-[#6]\[#6]=[#6](/[#6])-[#6] |r,TLB:16:15:10.4.3:1| InChI=1S/C19H5NO/c1-13(2)7-9-20-10-8-19(4)14(3)18(20)11-15-5-6-16(21)12-17(15)19/h5-6,12,14,18H NTESFUMRHWXLJE-UHFFFAOYSA-N 50035131 (1S,9S,13S)-1,13-dimethyl-10-(3-methylbut-2-enyl)-10-azatricyclo[7.3.1.0~2,7~]trideca-2,4,6-trien-4-ol::6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol anion::(2R,6R,11R)-6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::CHEMBL60542::(2R,6R,11S)-6,11-dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol((+)pentazocine)::(2S,3R,6S,11S)-6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol ((+)-pentazocine)::(+)-(6R,11S)-6,11-dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::(2S,6S,11S)-6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-ethano-benzo[d]azocin-8-ol(+)-pentazocine::6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::(6R,11S)-6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::(-)-PENTAZOCINE Sigma non-opioid intracellular receptor 1 Rattus norvegicus 1540 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50035131 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50035131&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 12259685 103943179 CHEMBL60542 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50772408 [#6]-[#6]1-[#6]-2-[#6]-c3ccccc3C1([#6])[#6]-[#6]-[#7]-2-[#6]\[#6]=[#6](\[#6])-[#6] |TLB:15:14:1:9.3.4,8:9:1:14.12.13| InChI=1S/C19H4N/c1-14(2)9-11-20-12-10-19(4)15(3)18(20)13-16-7-5-6-8-17(16)19/h5-8H FONCFTOYRBTYTR-UHFFFAOYSA-N 50032404 6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL330601 Sigma non-opioid intracellular receptor 1 Homo sapiens 1.57 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032404 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032404&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767674 103940933 CHEMBL330601 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50772411 CC1C2Cc3ccc(N)cc3C1(C)CCN2Cc1ccccc1 |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C21H26N2/c1-15-20-12-17-8-9-18(22)13-19(17)21(15,2)10-11-23(20)14-16-6-4-3-5-7-16/h3-9,13,15,20H,10-12,14,22H2,1-2H3 NHASLWXLZLGRMJ-UHFFFAOYSA-N 50032406 3-Benzyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ylamine::CHEMBL102406 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 832 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032406 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032406&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767678 103940935 CHEMBL102406 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50772413 CC1C2Cc3ccc(cc3C1(C)CCN2Cc1ccccc1)N(C)C |TLB:8:9:1:14.12.13,15:14:1:9.4.3| InChI=1S/C23H30N2/c1-17-22-14-19-10-11-20(24(3)4)15-21(19)23(17,2)12-13-25(22)16-18-8-6-5-7-9-18/h5-11,15,17,22H,12-14,16H2,1-4H3 RWYOXWWPQFYBCZ-UHFFFAOYSA-N 50032407 (3-Benzyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-yl)-dimethyl-amine::CHEMBL103816 Sigma non-opioid intracellular receptor 1 Homo sapiens 1.8 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032407 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032407&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767679 103940936 CHEMBL103816 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50772414 CC1C2Cc3ccc(NC(C)=O)cc3C1(C)CCN2Cc1ccccc1 |TLB:19:18:1:13.4.3,12:13:1:18.16.17| InChI=1S/C23H28N2O/c1-16-22-13-19-9-10-20(24-17(2)26)14-21(19)23(16,3)11-12-25(22)15-18-7-5-4-6-8-18/h4-10,14,16,22H,11-13,15H2,1-3H3,(H,24,26) FTFOZMMDMFOELO-UHFFFAOYSA-N 50032408 N-(3-Benzyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-yl)-acetamide::CHEMBL419343 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 1410 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032408 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032408&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767677 103940937 CHEMBL419343 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50772416 CC1C2Cc3ccc(O)cc3C1(C)CCN2CC=C |TLB:9:10:1:15.13.14,16:15:1:10.4.3| InChI=1S/C17H23NO/c1-4-8-18-9-7-17(3)12(2)16(18)10-13-5-6-14(19)11-15(13)17/h4-6,11-12,16,19H,1,7-10H2,2-3H3 LGQCVMYAEFTEFN-UHFFFAOYSA-N 50009063 3-Allyl-8-hydroxy-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocinium::CHEMBL274099::(+)3-Allyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::3-Allyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol Sigma non-opioid intracellular receptor 1 Homo sapiens 60 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50009063 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50009063&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 1235 103922121 CHEMBL274099 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50772418 [#6]-[#6]1-[#6]-2-[#6]-c3ccc(F)cc3C1([#6])[#6]-[#6]-[#7]-2-[#6]\[#6]=[#6](/[#6])-[#6] |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C19H3FN/c1-13(2)7-9-21-10-8-19(4)14(3)18(21)11-15-5-6-16(20)12-17(15)19/h5-6,12H YBLJVWMBCZWVFL-UHFFFAOYSA-N 50032409 8-Fluoro-6,11-dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL103157 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 52 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032409 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032409&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10085466 103940938 CHEMBL103157 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50772420 CC1C2Cc3ccc(O)cc3C1(C)CCN2Cc1ccccc1 |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C21H25NO/c1-15-20-12-17-8-9-18(23)13-19(17)21(15,2)10-11-22(20)14-16-6-4-3-5-7-16/h3-9,13,15,20,23H,10-12,14H2,1-2H3 RPMPAQXGZYLEST-UHFFFAOYSA-N 50032410 3-Benzyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::CHEMBL318877 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 1710 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032410 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032410&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90748 103940939 CHEMBL318877 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50772421 CC(C)CCN1CCC2(C)C(C)C1Cc1ccc(F)cc21 |TLB:4:5:10:20.14.13,THB:19:20:10:5.7.6| 50032411 8-Fluoro-6,11-dimethyl-3-(3-methyl-butyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL103156 Sigma non-opioid intracellular receptor 1 Homo sapiens 4.7 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032411 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032411&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767685 103940940 CHEMBL103156 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50772423 CC1C2Cc3ccc(O)cc3C1(C)CCN2Cc1ccccc1 |TLB:9:10:1:15.13.14,16:15:1:10.4.3| InChI=1S/C21H25NO/c1-15-20-12-17-8-9-18(23)13-19(17)21(15,2)10-11-22(20)14-16-6-4-3-5-7-16/h3-9,13,15,20,23H,10-12,14H2,1-2H3 RPMPAQXGZYLEST-UHFFFAOYSA-N 50032412 3-Benzyl-6,11-dimethyl-1,3,4,5,6,7-hexahydro-2H-2,6-methano-benzo[d]azocin-8-one::CHEMBL103319 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 691 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032412 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032412&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90748 103940941 CHEMBL103319 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50772424 [#6]-[#6]1-[#6]-2-[#6]-c3ccc(F)cc3C1([#6])[#6]-[#6]-[#7]-2-[#6]\[#6]=[#6](/[#6])-[#6] |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C19H3FN/c1-13(2)7-9-21-10-8-19(4)14(3)18(21)11-15-5-6-16(20)12-17(15)19/h5-6,12H YBLJVWMBCZWVFL-UHFFFAOYSA-N 50032409 8-Fluoro-6,11-dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL103157 Sigma non-opioid intracellular receptor 1 Homo sapiens 30.5 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032409 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032409&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 10085466 103940938 CHEMBL103157 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50772426 CC1C2Cc3ccc(N)cc3C1(C)CCN2Cc1ccccc1 |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C21H26N2/c1-15-20-12-17-8-9-18(22)13-19(17)21(15,2)10-11-23(20)14-16-6-4-3-5-7-16/h3-9,13,15,20H,10-12,14,22H2,1-2H3 NHASLWXLZLGRMJ-UHFFFAOYSA-N 50032406 3-Benzyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ylamine::CHEMBL102406 Sigma non-opioid intracellular receptor 1 Homo sapiens 1.5 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032406 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032406&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767678 103940935 CHEMBL102406 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50772427 CC1C2Cc3ccc(cc3C1(C)CCN2Cc1ccccc1)N(C)C |TLB:8:9:1:14.12.13,15:14:1:9.4.3| InChI=1S/C23H30N2/c1-17-22-14-19-10-11-20(24(3)4)15-21(19)23(17,2)12-13-25(22)16-18-8-6-5-7-9-18/h5-11,15,17,22H,12-14,16H2,1-4H3 RWYOXWWPQFYBCZ-UHFFFAOYSA-N 50032407 (3-Benzyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-yl)-dimethyl-amine::CHEMBL103816 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 258 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032407 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032407&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767679 103940936 CHEMBL103816 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50772428 CC1C2Cc3ccccc3C1(C)CCN2Cc1ccccc1 |TLB:15:14:1:9.3.4,8:9:1:14.12.13| InChI=1S/C21H25N/c1-16-20-14-18-10-6-7-11-19(18)21(16,2)12-13-22(20)15-17-8-4-3-5-9-17/h3-11,16,20H,12-15H2,1-2H3 QAAXWTHVNTVMCJ-UHFFFAOYSA-N 50032405 3-Benzyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL101607 Sigma non-opioid intracellular receptor 1 Homo sapiens 18.4 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032405 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032405&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767676 103940934 CHEMBL101607 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50772429 CC1C2Cc3ccc(I)cc3C1(C)CCN2Cc1ccccc1 |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C21H24IN/c1-15-20-12-17-8-9-18(22)13-19(17)21(15,2)10-11-23(20)14-16-6-4-3-5-7-16/h3-9,13,15,20H,10-12,14H2,1-2H3 KAICFMDUDWIURZ-UHFFFAOYSA-N 50032413 3-Benzyl-8-iodo-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL100789 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 2037 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032413 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032413&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767684 103940942 CHEMBL100789 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50772430 CC1C2Cc3ccccc3C1(C)CCN2C |TLB:15:14:1:9.3.4,8:9:1:14.12.13| InChI=1S/C15H21N/c1-11-14-10-12-6-4-5-7-13(12)15(11,2)8-9-16(14)3/h4-7,11,14H,8-10H2,1-3H3 UPIJLTVYDZRYJT-UHFFFAOYSA-N 50032414 3,6,11-Trimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL101732 Sigma non-opioid intracellular receptor 1 Homo sapiens 482 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032414 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032414&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 3041078 103940943 CHEMBL101732 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50772433 CC1C2Cc3ccc(NS(C)(=O)=O)cc3C1(C)CCN2Cc1ccccc1 |TLB:20:19:1:14.4.3,13:14:1:19.17.18| InChI=1S/C22H28N2O2S/c1-16-21-13-18-9-10-19(23-27(3,25)26)14-20(18)22(16,2)11-12-24(21)15-17-7-5-4-6-8-17/h4-10,14,16,21,23H,11-13,15H2,1-3H3 PBEYSGZDOQLDOT-UHFFFAOYSA-N 50032416 N-(3-Benzyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-yl)-methanesulfonamide::CHEMBL317354 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 1900 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032416 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032416&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767680 103940945 CHEMBL317354 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50772434 CC1C2Cc3ccc(I)cc3C1(C)CCN2Cc1ccccc1 |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C21H24IN/c1-15-20-12-17-8-9-18(22)13-19(17)21(15,2)10-11-23(20)14-16-6-4-3-5-7-16/h3-9,13,15,20H,10-12,14H2,1-2H3 KAICFMDUDWIURZ-UHFFFAOYSA-N 50032413 3-Benzyl-8-iodo-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL100789 Sigma non-opioid intracellular receptor 1 Homo sapiens 131 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032413 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032413&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767684 103940942 CHEMBL100789 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50772435 CC(C)CCN1CCC2(C)C(C)C1Cc1ccc(F)cc21 |TLB:4:5:10:20.14.13,THB:19:20:10:5.7.6| 50032411 8-Fluoro-6,11-dimethyl-3-(3-methyl-butyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL103156 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 56 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032411 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032411&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767685 103940940 CHEMBL103156 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50772436 CC1C2Cc3ccccc3C1(C)CCN2Cc1ccccc1 |TLB:15:14:1:9.3.4,8:9:1:14.12.13| InChI=1S/C21H25N/c1-16-20-14-18-10-6-7-11-19(18)21(16,2)12-13-22(20)15-17-8-4-3-5-9-17/h3-11,16,20H,12-15H2,1-2H3 QAAXWTHVNTVMCJ-UHFFFAOYSA-N 50032405 3-Benzyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL101607 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 487 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032405 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032405&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767676 103940934 CHEMBL101607 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50772439 CC1C2Cc3ccc(Br)cc3C1(C)CCN2Cc1ccccc1 |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C21H24BrN/c1-15-20-12-17-8-9-18(22)13-19(17)21(15,2)10-11-23(20)14-16-6-4-3-5-7-16/h3-9,13,15,20H,10-12,14H2,1-2H3 RFIKUGPYXNCFAU-UHFFFAOYSA-N 50032417 3-Benzyl-8-bromo-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL99854 Sigma non-opioid intracellular receptor 1 Homo sapiens 19 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032417 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032417&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767683 103940946 CHEMBL99854 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50772441 CC1C2Cc3ccc(Cl)cc3C1(C)CCN2Cc1ccccc1 |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C21H24ClN/c1-15-20-12-17-8-9-18(22)13-19(17)21(15,2)10-11-23(20)14-16-6-4-3-5-7-16/h3-9,13,15,20H,10-12,14H2,1-2H3 SFRKZPDHORQPCB-UHFFFAOYSA-N 50032415 3-Benzyl-8-chloro-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL276078 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 381 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032415 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032415&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767682 103940944 CHEMBL276078 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50772442 CC1C2Cc3ccc(F)cc3C1(C)CCN2Cc1ccccc1 |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C21H24FN/c1-15-20-12-17-8-9-18(22)13-19(17)21(15,2)10-11-23(20)14-16-6-4-3-5-7-16/h3-9,13,15,20H,10-12,14H2,1-2H3 GMSWWAYLXZJZCL-UHFFFAOYSA-N 50032401 3-Benzyl-8-fluoro-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL101300 Sigma non-opioid intracellular receptor 1 Homo sapiens 19.6 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032401 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032401&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767681 103940930 CHEMBL101300 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50772443 CC1C2Cc3ccc(Cl)cc3C1(C)CCN2Cc1ccccc1 |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C21H24ClN/c1-15-20-12-17-8-9-18(22)13-19(17)21(15,2)10-11-23(20)14-16-6-4-3-5-7-16/h3-9,13,15,20H,10-12,14H2,1-2H3 SFRKZPDHORQPCB-UHFFFAOYSA-N 50032415 3-Benzyl-8-chloro-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL276078 Sigma non-opioid intracellular receptor 1 Homo sapiens 40.1 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032415 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032415&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767682 103940944 CHEMBL276078 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50772444 CC1C2Cc3ccc(O)cc3C1(C)CCN2CC=C |TLB:9:10:1:15.13.14,16:15:1:10.4.3| InChI=1S/C17H23NO/c1-4-8-18-9-7-17(3)12(2)16(18)10-13-5-6-14(19)11-15(13)17/h4-6,11-12,16,19H,1,7-10H2,2-3H3 LGQCVMYAEFTEFN-UHFFFAOYSA-N 50009063 3-Allyl-8-hydroxy-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocinium::CHEMBL274099::(+)3-Allyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::3-Allyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol Sigma non-opioid intracellular receptor 1 Rattus norvegicus >10000 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50009063 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50009063&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 1235 103922121 CHEMBL274099 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50772445 CC1C2Cc3ccc(NC(C)=O)cc3C1(C)CCN2Cc1ccccc1 |TLB:19:18:1:13.4.3,12:13:1:18.16.17| InChI=1S/C23H28N2O/c1-16-22-13-19-9-10-20(24-17(2)26)14-21(19)23(16,3)11-12-25(22)15-18-7-5-4-6-8-18/h4-10,14,16,22H,11-13,15H2,1-3H3,(H,24,26) FTFOZMMDMFOELO-UHFFFAOYSA-N 50032408 N-(3-Benzyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-yl)-acetamide::CHEMBL419343 Sigma non-opioid intracellular receptor 1 Homo sapiens 5.7 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032408 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032408&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767677 103940937 CHEMBL419343 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50772446 [#6]-[#6]1-[#6]-2-[#6]-c3ccccc3C1([#6])[#6]-[#6]-[#7]-2-[#6]\[#6]=[#6](\[#6])-[#6] |TLB:15:14:1:9.3.4,8:9:1:14.12.13| InChI=1S/C19H4N/c1-14(2)9-11-20-12-10-19(4)15(3)18(20)13-16-7-5-6-8-17(16)19/h5-8H FONCFTOYRBTYTR-UHFFFAOYSA-N 50032404 6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL330601 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 295 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032404 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032404&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767674 103940933 CHEMBL330601 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50772447 CC1C2Cc3ccc(O)cc3C1(C)CCN2Cc1ccccc1 |TLB:9:10:1:15.13.14,16:15:1:10.4.3| InChI=1S/C21H25NO/c1-15-20-12-17-8-9-18(23)13-19(17)21(15,2)10-11-22(20)14-16-6-4-3-5-7-16/h3-9,13,15,20,23H,10-12,14H2,1-2H3 RPMPAQXGZYLEST-UHFFFAOYSA-N 50032412 3-Benzyl-6,11-dimethyl-1,3,4,5,6,7-hexahydro-2H-2,6-methano-benzo[d]azocin-8-one::CHEMBL103319 Sigma non-opioid intracellular receptor 1 Homo sapiens 11 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032412 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032412&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90748 103940941 CHEMBL103319 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50772448 C[C@H]1[C@@H]2Cc3ccc(O)cc3[C@]1(C)CCN2C |THB:16:15:1:4.10.3| 50367062 METAZOCINE Sigma non-opioid intracellular receptor 1 Homo sapiens 2100 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50367062 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50367062&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 3037886 160846164 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50772449 CC1C2Cc3ccc(Br)cc3C1(C)CCN2Cc1ccccc1 |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C21H24BrN/c1-15-20-12-17-8-9-18(22)13-19(17)21(15,2)10-11-23(20)14-16-6-4-3-5-7-16/h3-9,13,15,20H,10-12,14H2,1-2H3 RFIKUGPYXNCFAU-UHFFFAOYSA-N 50032417 3-Benzyl-8-bromo-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocine::CHEMBL99854 Sigma non-opioid intracellular receptor 1 Rattus norvegicus 501 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032417 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000889&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032417&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767683 103940946 CHEMBL99854 1 MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP Sigma non-opioid intracellular receptor 1 SGMR1_RAT Q9R0C9 Q9R1J7 Q9Z2W2 50772450 [#6]-[#6@@H]1-[#6@@H]-2-[#6]-c3ccc(-[#8])cc3[C@@]1([#6])[#6]-[#6]-[#7]-2-[#6]\[#6]=[#6](/[#6])-[#6] |r,TLB:16:15:10.4.3:1| InChI=1S/C19H5NO/c1-13(2)7-9-20-10-8-19(4)14(3)18(20)11-15-5-6-16(21)12-17(15)19/h5-6,12,14,18H NTESFUMRHWXLJE-UHFFFAOYSA-N 50035131 (1S,9S,13S)-1,13-dimethyl-10-(3-methylbut-2-enyl)-10-azatricyclo[7.3.1.0~2,7~]trideca-2,4,6-trien-4-ol::6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol anion::(2R,6R,11R)-6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::CHEMBL60542::(2R,6R,11S)-6,11-dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol((+)pentazocine)::(2S,3R,6S,11S)-6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol ((+)-pentazocine)::(+)-(6R,11S)-6,11-dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::(2S,6S,11S)-6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-ethano-benzo[d]azocin-8-ol(+)-pentazocine::6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::(6R,11S)-6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::(-)-PENTAZOCINE Sigma non-opioid intracellular receptor 1 Homo sapiens 3.1 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50035131 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50035131&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 12259685 103943179 CHEMBL60542 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50772451 CC1C2Cc3ccc(NS(C)(=O)=O)cc3C1(C)CCN2Cc1ccccc1 |TLB:20:19:1:14.4.3,13:14:1:19.17.18| InChI=1S/C22H28N2O2S/c1-16-21-13-18-9-10-19(23-27(3,25)26)14-20(18)22(16,2)11-12-24(21)15-17-7-5-4-6-8-17/h4-10,14,16,21,23H,11-13,15H2,1-3H3 PBEYSGZDOQLDOT-UHFFFAOYSA-N 50032416 N-(3-Benzyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-yl)-methanesulfonamide::CHEMBL317354 Sigma non-opioid intracellular receptor 1 Homo sapiens 10 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032416 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032416&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15767680 103940945 CHEMBL317354 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50772452 CC1C2Cc3ccc(O)cc3C1(C)CCN2Cc1ccccc1 |TLB:16:15:1:10.4.3,9:10:1:15.13.14| InChI=1S/C21H25NO/c1-15-20-12-17-8-9-18(23)13-19(17)21(15,2)10-11-22(20)14-16-6-4-3-5-7-16/h3-9,13,15,20,23H,10-12,14H2,1-2H3 RPMPAQXGZYLEST-UHFFFAOYSA-N 50032410 3-Benzyl-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol::CHEMBL318877 Sigma non-opioid intracellular receptor 1 Homo sapiens 0.670 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032410 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032410&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 90748 103940939 CHEMBL318877 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0 50993290 [#6]-[#6@@H]1-[#6@H]-2-[#6]-c3ccc(-[#8])cc3[C@]1([#6])[#6]-[#6]-[#7]-2-[#6]\[#6]=[#6](/[#6])-[#6] |r,TLB:16:15:1:10.4.3| InChI=1S/C19H5NO/c1-13(2)7-9-20-10-8-19(4)14(3)18(20)11-15-5-6-16(21)12-17(15)19/h5-6,12,14,18H NTESFUMRHWXLJE-UHFFFAOYSA-N 50407300 CHEMBL397705 Sigma non-opioid intracellular receptor 1 Homo sapiens 83.1 ChEMBL 10.1021/jm00015a022 10.7270/Q2V988RP 7636860 Danso-Danquah, R; Bai, X; Zhang, X; Mascarella, SW; Williams, W; Sine, B; Bowen, WD; Carroll, FI 9/12/1995 10/30/2012 Research Triangle Institute http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50407300 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000996&target=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50407300&enzyme=Sigma+non-opioid+intracellular+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 9669 163356324 CHEMBL397705 1 MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP 6DK1,6DK0,6DJZ,5HK2,5HK1 Sigma non-opioid intracellular receptor 1 SGMR1_HUMAN Q99720 D3DRM7 O00673 O00725 Q0Z9W6 Q153Z1 Q2TSD1 Q53GN2 Q7Z653 Q8N7H3 Q9NYX0