BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50039708 CCCc1nc(CC)c(C(=O)CCN(C(=O)c2ccccc2)c2ccccc2)n1Cc1ccc(cc1F)-c1ccccc1S(=O)(=O)NC(=O)OCCC(C)C InChI=1S/C43H47FN4O6S/c1-5-15-40-45-37(6-2)41(38(49)24-26-47(34-18-11-8-12-19-34)42(50)31-16-9-7-10-17-31)48(40)29-33-23-22-32(28-36(33)44)35-20-13-14-21-39(35)55(52,53)46-43(51)54-27-25-30(3)4/h7-14,16-23,28,30H,5-6,15,24-27,29H2,1-4H3,(H,46,51) ADYRAXCAXZNNFK-UHFFFAOYSA-N 50032352 isopentyloxy 2-[2-(4-{4-ethyl-5-[3-biphenylcarboxamidopropanoyl]-2-propyl-1H-1-imidazolylmethyl}-3-fluorophenyl)phenylsulfonyl]caboxamido::butyloxy 2-[2-(4-{4-ethyl-5-[3-diphenylcarboxamidopropanoyl]-2-propyl-1H-1-imidazolylmethyl}-3-fluorophenyl)phenylsulfonyl]caboxamido::CHEMBL98665 Type-2 angiotensin II receptor Rattus norvegicus 0.180 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032352 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032352&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 10033116 103940882 CHEMBL98665 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50039709 CCCCOC(=O)NS(=O)(=O)c1ccccc1-c1ccc(Cn2c(CCC)nc(CC)c2C(C)=O)c(F)c1 InChI=1S/C28H34FN3O5S/c1-5-8-16-37-28(34)31-38(35,36)25-13-10-9-12-22(25)20-14-15-21(23(29)17-20)18-32-26(11-6-2)30-24(7-3)27(32)19(4)33/h9-10,12-15,17H,5-8,11,16,18H2,1-4H3,(H,31,34) SEXCTFJUJONZSQ-UHFFFAOYSA-N 50032364 4'-(5-Acetyl-4-ethyl-2-propyl-imidazol-1-ylmethyl)-3'-fluoro-biphenyl-2-sulfonic acid butyloxycarbonylamide(EXP970)::butyloxy 2-{2-[3-flouoro-4-(4-ethyl-5-methyloxycarbonyl-2-propyl-1H-1-imidazolylmethyl)phenyl]phenylsulfonyl}carbonylamino::4'-(5-Acetyl-4-ethyl-2-propyl-imidazol-1-ylmethyl)-3'-fluoro-biphenyl-2-sulfonic acid N-(butyloxycarbonyl)amide::CHEMBL60942 Type-2 angiotensin II receptor Rattus norvegicus 10 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032364 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032364&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 9937227 103940894 CHEMBL60942 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50039710 CCCc1nc(CC)c(C(=O)OC)n1Cc1ccc(cc1F)-c1ccccc1S(=O)(=O)NC(=O)OCCC(C)C InChI=1S/C29H36FN3O6S/c1-6-10-26-31-24(7-2)27(28(34)38-5)33(26)18-21-14-13-20(17-23(21)30)22-11-8-9-12-25(22)40(36,37)32-29(35)39-16-15-19(3)4/h8-9,11-14,17,19H,6-7,10,15-16,18H2,1-5H3,(H,32,35) PZLBCNBODYEVNF-UHFFFAOYSA-N 50032362 3-(2'-Isopentyloxycarbonylsulfamoyl-3-fluoro-biphenyl-4-ylmethyl)-5-ethyl-2-propyl-3H-imidazole-4-carboxylic acid methyl ester::isopentyloxy 2-{2-[3-flouoro-4-(4-ethyl-5-methyloxycarbonyl-2-propyl-1H-1-imidazolylmethyl)phenyl]phenylsulfonyl}carbonylamino::5-Ethyl-3-(3-fluoro-2'-isopentyloxycarbonylsulfamoyl-biphenyl-4-ylmethyl)-2-propyl-3H-imidazole-4-carboxylic acid methyl ester(EXP408)::CHEMBL294512 Type-2 angiotensin II receptor Rattus norvegicus 40 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032362 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032362&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 9851082 103940892 CHEMBL294512 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50039711 CCCCOC(=O)NS(=O)(=O)c1ccccc1-c1ccc(Cn2c(CCC)nc(CC)c2C(=O)OC)c(Cl)c1 InChI=1S/C28H34ClN3O6S/c1-5-8-16-38-28(34)31-39(35,36)24-13-10-9-12-21(24)19-14-15-20(22(29)17-19)18-32-25(11-6-2)30-23(7-3)26(32)27(33)37-4/h9-10,12-15,17H,5-8,11,16,18H2,1-4H3,(H,31,34) AWIVWBRKOUQKEI-UHFFFAOYSA-N 50032351 3-(2'-Butyloxycarbonylsulfamoyl-3-chloro-biphenyl-4-ylmethyl)-5-ethyl-2-propyl-3H-imidazole-4-carboxylic acid methyl ester::butyloxy 2-{2-[3-chloro-4-(4-ethyl-5-methyloxycarbonyl-2-propyl-1H-1-imidazolylmethyl)phenyl]phenylsulfonyl}carbonylamino::CHEMBL304022 Type-2 angiotensin II receptor Rattus norvegicus 37 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032351 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032351&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 9938088 103940881 CHEMBL304022 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50049101 CCCc1nc(CC)c(C(=O)CCN(C(=O)c2ccccc2)c2ccccc2)n1Cc1ccc(cc1F)-c1ccccc1S(=O)(=O)NC(=O)OCCC(C)C InChI=1S/C43H47FN4O6S/c1-5-15-40-45-37(6-2)41(38(49)24-26-47(34-18-11-8-12-19-34)42(50)31-16-9-7-10-17-31)48(40)29-33-23-22-32(28-36(33)44)35-20-13-14-21-39(35)55(52,53)46-43(51)54-27-25-30(3)4/h7-14,16-23,28,30H,5-6,15,24-27,29H2,1-4H3,(H,46,51) ADYRAXCAXZNNFK-UHFFFAOYSA-N 50032352 isopentyloxy 2-[2-(4-{4-ethyl-5-[3-biphenylcarboxamidopropanoyl]-2-propyl-1H-1-imidazolylmethyl}-3-fluorophenyl)phenylsulfonyl]caboxamido::butyloxy 2-[2-(4-{4-ethyl-5-[3-diphenylcarboxamidopropanoyl]-2-propyl-1H-1-imidazolylmethyl}-3-fluorophenyl)phenylsulfonyl]caboxamido::CHEMBL98665 Type-2 angiotensin II receptor Rattus norvegicus 0.18 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032352 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032352&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 10033116 103940882 CHEMBL98665 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50049104 CCCN(CCC(=O)c1c(CC)nc(CCC)n1Cc1ccc(cc1F)-c1ccccc1S(=O)(=O)NC(=O)OCCC(C)C)C(=O)CCC InChI=1S/C37H51FN4O6S/c1-7-13-34-39-31(10-4)36(32(43)19-22-41(21-9-3)35(44)14-8-2)42(34)25-28-18-17-27(24-30(28)38)29-15-11-12-16-33(29)49(46,47)40-37(45)48-23-20-26(5)6/h11-12,15-18,24,26H,7-10,13-14,19-23,25H2,1-6H3,(H,40,45) VAYOSZUZRWJZDI-UHFFFAOYSA-N 50032355 butyloxy 2-(2-{4-[5-(3-dipropylcarboxamidopropanoyl)-4-ethyl-2-propyl-1H-1-imidazolylmethyl]-3-fluorophenyl}phenylsulfonyl)carbonylamino::CHEMBL101039 Type-2 angiotensin II receptor Rattus norvegicus 5 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032355 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032355&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 44330904 103940885 CHEMBL101039 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50049107 CCCc1nc(CC)c(C(=O)CCN(C(=O)c2ccncc2)c2cccnc2)n1Cc1ccc(cc1F)-c1ccccc1S(=O)(=O)NC(=O)OCCC(C)C InChI=1S/C41H45FN6O6S/c1-5-10-38-45-35(6-2)39(36(49)18-23-47(32-11-9-20-44-26-32)40(50)29-16-21-43-22-17-29)48(38)27-31-15-14-30(25-34(31)42)33-12-7-8-13-37(33)55(52,53)46-41(51)54-24-19-28(3)4/h7-9,11-17,20-22,25-26,28H,5-6,10,18-19,23-24,27H2,1-4H3,(H,46,51) OMCVRNWRNGRKRB-UHFFFAOYSA-N 50032356 isopentyloxy 2-[2-(4-{4-ethyl-5-[3-[3-pyridyl(4-pyridyl)carboxamidopropanoyl]-2-propyl-1H-1-imidazolylmethyl}-3-fluorophenyl)phenylsulfonyl]caboxamido::CHEMBL317159 Type-2 angiotensin II receptor Rattus norvegicus 1 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032356 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032356&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 10395395 103940886 CHEMBL317159 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50049109 CCCc1nc(CC)c(C(=O)CCN(C(=O)c2cccnc2)c2cccnc2)n1Cc1ccc(cc1)-c1ccccc1S(=O)(=O)NC(=O)OCCC(C)C InChI=1S/C41H46N6O6S/c1-5-11-38-44-35(6-2)39(36(48)20-24-46(33-13-10-23-43-27-33)40(49)32-12-9-22-42-26-32)47(38)28-30-16-18-31(19-17-30)34-14-7-8-15-37(34)54(51,52)45-41(50)53-25-21-29(3)4/h7-10,12-19,22-23,26-27,29H,5-6,11,20-21,24-25,28H2,1-4H3,(H,45,50) AKWIQXGPKTWFNO-UHFFFAOYSA-N 50032357 isopentyloxy 2-[2-(4-{4-ethyl-5-[3-[3-pyridyl(3-pyridyl)carboxamidopropanoyl]-2-propyl-1H-1-imidazolylmethyl}-3-phenyl)phenylsulfonyl]caboxamido::CHEMBL328602 Type-2 angiotensin II receptor Rattus norvegicus 1 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032357 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032357&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 10033013 103940887 CHEMBL328602 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50049111 CCCc1nc(CC)c(C(=O)CCN(C(=O)CC)c2cccnc2)n1Cc1ccc(cc1F)-c1ccccc1S(=O)(=O)NC(=O)OCCC(C)C InChI=1S/C38H46FN5O6S/c1-6-12-35-41-32(7-2)37(33(45)18-21-43(36(46)8-3)29-13-11-20-40-24-29)44(35)25-28-17-16-27(23-31(28)39)30-14-9-10-15-34(30)51(48,49)42-38(47)50-22-19-26(4)5/h9-11,13-17,20,23-24,26H,6-8,12,18-19,21-22,25H2,1-5H3,(H,42,47) YKVRFZWWKWSMGD-UHFFFAOYSA-N 50032359 isopentyloxy 2-[2-(4-{4-ethyl-5-[3-[3-pyridyl(ethyl)carboxamidopropanoyl]-2-propyl-1H-1-imidazolylmethyl}-3-fluorophenyl)phenylsulfonyl]caboxamido::CHEMBL316503 Type-2 angiotensin II receptor Rattus norvegicus 0.49 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032359 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032359&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 10485034 103940889 CHEMBL316503 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50049112 CCCc1nc(CC)c(C(=O)CCN(C(C)=O)c2cccnc2)n1Cc1ccc(cc1F)-c1ccccc1S(=O)(=O)NC(=O)OCCC(C)C InChI=1S/C37H44FN5O6S/c1-6-11-35-40-32(7-2)36(33(45)17-20-42(26(5)44)29-12-10-19-39-23-29)43(35)24-28-16-15-27(22-31(28)38)30-13-8-9-14-34(30)50(47,48)41-37(46)49-21-18-25(3)4/h8-10,12-16,19,22-23,25H,6-7,11,17-18,20-21,24H2,1-5H3,(H,41,46) ORVHDVAXVNPYEQ-UHFFFAOYSA-N 50032361 isopentyloxy 2-[2-(4-{4-ethyl-5-[3-[3-pyridyl(methyl)carboxamidopropanoyl]-2-propyl-1H-1-imidazolylmethyl}-3-fluorophenyl)phenylsulfonyl]caboxamido::CHEMBL415502 Type-2 angiotensin II receptor Rattus norvegicus 3 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032361 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032361&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 9987283 103940891 CHEMBL415502 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50049115 CCCCN(CCC(=O)c1c(CC)nc(CCC)n1Cc1ccc(cc1F)-c1ccccc1S(=O)(=O)NC(=O)OCCC(C)C)C(=O)c1ccccc1 InChI=1S/C41H51FN4O6S/c1-6-9-24-45(40(48)30-16-11-10-12-17-30)25-22-36(47)39-35(8-3)43-38(15-7-2)46(39)28-32-21-20-31(27-34(32)42)33-18-13-14-19-37(33)53(50,51)44-41(49)52-26-23-29(4)5/h10-14,16-21,27,29H,6-9,15,22-26,28H2,1-5H3,(H,44,49) KTMYVCAOZHCVIH-UHFFFAOYSA-N 50032363 butyloxy 2-[2-(4-{4-ethyl-5-[3-phenyl(butyl)carboxamidopropanoyl]-2-propyl-1H-1-imidazolylmethyl}-3-fluorophenyl)phenylsulfonyl]caboxamido::CHEMBL101455 Type-2 angiotensin II receptor Rattus norvegicus 10 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032363 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032363&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 44330905 103940893 CHEMBL101455 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50049119 CCCCOC(=O)NS(=O)(=O)c1ccccc1-c1ccc(Cn2c(CCC)nc(CC)c2C(C)=O)c(F)c1 InChI=1S/C28H34FN3O5S/c1-5-8-16-37-28(34)31-38(35,36)25-13-10-9-12-22(25)20-14-15-21(23(29)17-20)18-32-26(11-6-2)30-24(7-3)27(32)19(4)33/h9-10,12-15,17H,5-8,11,16,18H2,1-4H3,(H,31,34) SEXCTFJUJONZSQ-UHFFFAOYSA-N 50032364 4'-(5-Acetyl-4-ethyl-2-propyl-imidazol-1-ylmethyl)-3'-fluoro-biphenyl-2-sulfonic acid butyloxycarbonylamide(EXP970)::butyloxy 2-{2-[3-flouoro-4-(4-ethyl-5-methyloxycarbonyl-2-propyl-1H-1-imidazolylmethyl)phenyl]phenylsulfonyl}carbonylamino::4'-(5-Acetyl-4-ethyl-2-propyl-imidazol-1-ylmethyl)-3'-fluoro-biphenyl-2-sulfonic acid N-(butyloxycarbonyl)amide::CHEMBL60942 Type-2 angiotensin II receptor Rattus norvegicus 10 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032364 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032364&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 9937227 103940894 CHEMBL60942 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50049121 CCCc1nc(CC)c(C(=O)CCN(C(=O)c2ccncc2)c2ccccc2)n1Cc1ccc(cc1F)-c1ccccc1S(=O)(=O)NC(=O)OCCC(C)C InChI=1S/C42H46FN5O6S/c1-5-12-39-45-36(6-2)40(37(49)21-25-47(33-13-8-7-9-14-33)41(50)30-19-23-44-24-20-30)48(39)28-32-18-17-31(27-35(32)43)34-15-10-11-16-38(34)55(52,53)46-42(51)54-26-22-29(3)4/h7-11,13-20,23-24,27,29H,5-6,12,21-22,25-26,28H2,1-4H3,(H,46,51) RDIJTUXPTCZWED-UHFFFAOYSA-N 50032358 isopentyloxy 2-[2-(4-{4-ethyl-5-[3-phenyl(4-pyridyl)carboxamidopropanoyl]-2-propyl-1H-1-imidazolylmethyl}-3-fluorophenyl)phenylsulfonyl]caboxamido::CHEMBL430659 Type-2 angiotensin II receptor Rattus norvegicus 0.1 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032358 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032358&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 10440174 103940888 CHEMBL430659 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50049123 CCCC(=O)N(CCC(=O)c1c(CC)nc(CCC)n1Cc1ccc(cc1)-c1ccccc1S(=O)(=O)NC(=O)OCCC(C)C)c1cccnc1 InChI=1S/C39H49N5O6S/c1-6-12-36-41-33(8-3)38(34(45)21-24-43(37(46)13-7-2)31-14-11-23-40-26-31)44(36)27-29-17-19-30(20-18-29)32-15-9-10-16-35(32)51(48,49)42-39(47)50-25-22-28(4)5/h9-11,14-20,23,26,28H,6-8,12-13,21-22,24-25,27H2,1-5H3,(H,42,47) KVNRZBWFPQTUCB-UHFFFAOYSA-N 50032365 isopentyloxy 2-[2-(4-{4-ethyl-5-[3-[3-pyridyl(propyl)carboxamidopropanoyl]-2-propyl-1H-1-imidazolylmethyl}-3-phenyl)phenylsulfonyl]caboxamido::CHEMBL99112 Type-2 angiotensin II receptor Rattus norvegicus 1 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032365 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032365&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 10259277 103940895 CHEMBL99112 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50049125 CCCc1nc(CC)c(C(=O)CCN(C(=O)C(C)C)c2cccnc2)n1Cc1ccc(cc1F)-c1ccccc1S(=O)(=O)NC(=O)OCCC(C)C InChI=1S/C39H48FN5O6S/c1-7-12-36-42-33(8-2)37(34(46)18-21-44(38(47)27(5)6)30-13-11-20-41-24-30)45(36)25-29-17-16-28(23-32(29)40)31-14-9-10-15-35(31)52(49,50)43-39(48)51-22-19-26(3)4/h9-11,13-17,20,23-24,26-27H,7-8,12,18-19,21-22,25H2,1-6H3,(H,43,48) LOAHCDOOWRXUSA-UHFFFAOYSA-N 50032360 isopentyloxy 2-[2-(4-{4-ethyl-5-[3-[3-pyridyl(isopropyl)carboxamidopropanoyl]-2-propyl-1H-1-imidazolylmethyl}-3-fluorophenyl)phenylsulfonyl]caboxamido::CHEMBL98746 Type-2 angiotensin II receptor Rattus norvegicus 1 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032360 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032360&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 10078661 103940890 CHEMBL98746 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50049127 CCCN(CCC(=O)c1c(CC)nc(CCC)n1Cc1ccc(cc1F)-c1ccccc1S(=O)(=O)NC(=O)OCCC(C)C)C(=O)c1ccccc1 InChI=1S/C40H49FN4O6S/c1-6-14-37-42-34(8-3)38(35(46)21-24-44(23-7-2)39(47)29-15-10-9-11-16-29)45(37)27-31-20-19-30(26-33(31)41)32-17-12-13-18-36(32)52(49,50)43-40(48)51-25-22-28(4)5/h9-13,15-20,26,28H,6-8,14,21-25,27H2,1-5H3,(H,43,48) USZMBBMPEGRUGI-UHFFFAOYSA-N 50032366 butyloxy 2-[2-(4-{4-ethyl-5-[3-phenyl(propyl)carboxamidopropanoyl]-2-propyl-1H-1-imidazolylmethyl}-3-fluorophenyl)phenylsulfonyl]caboxamido::CHEMBL99438 Type-2 angiotensin II receptor Rattus norvegicus 4 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032366 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032366&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 44331176 103940896 CHEMBL99438 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50049129 CCCc1nc(CC)c(C(=O)CCN(C(=O)c2cccnc2)c2ccccn2)n1Cc1ccc(cc1F)-c1ccccc1S(=O)(=O)NC(=O)OCCC(C)C InChI=1S/C41H45FN6O6S/c1-5-12-38-45-34(6-2)39(35(49)19-23-47(37-16-9-10-22-44-37)40(50)30-13-11-21-43-26-30)48(38)27-31-18-17-29(25-33(31)42)32-14-7-8-15-36(32)55(52,53)46-41(51)54-24-20-28(3)4/h7-11,13-18,21-22,25-26,28H,5-6,12,19-20,23-24,27H2,1-4H3,(H,46,51) JRPXJLWXCAOCED-UHFFFAOYSA-N 50032367 isopentyloxy 2-[2-(4-{4-ethyl-5-[3-[2-pyridyl(4-pyridyl)carboxamidopropanoyl]-2-propyl-1H-1-imidazolylmethyl}-3-fluorophenyl)phenylsulfonyl]caboxamido::CHEMBL317962 Type-2 angiotensin II receptor Rattus norvegicus 0.16 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032367 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032367&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 10440179 103940897 CHEMBL317962 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50049131 CCCc1nc(CC)c(C(=O)CCN(C(=O)c2cccnc2)c2cccnc2)n1Cc1ccc(cc1F)-c1ccccc1S(=O)(=O)NC(=O)OCCC(C)C InChI=1S/C41H45FN6O6S/c1-5-11-38-45-35(6-2)39(36(49)18-22-47(32-13-10-21-44-26-32)40(50)30-12-9-20-43-25-30)48(38)27-31-17-16-29(24-34(31)42)33-14-7-8-15-37(33)55(52,53)46-41(51)54-23-19-28(3)4/h7-10,12-17,20-21,24-26,28H,5-6,11,18-19,22-23,27H2,1-4H3,(H,46,51) KJUJQDLWFSFQJI-UHFFFAOYSA-N 50032354 isopentyloxy 2-[2-(4-{4-ethyl-5-[3-[3-pyridyl(3-pyridyl)carboxamidopropanoyl]-2-propyl-1H-1-imidazolylmethyl}-3-fluorophenyl)phenylsulfonyl]caboxamido::CHEMBL433005 Type-2 angiotensin II receptor Rattus norvegicus 0.22 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032354 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032354&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 10033126 103940884 CHEMBL433005 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50049134 CCCC(=O)N(CCC(=O)c1c(CC)nc(CCC)n1Cc1ccc(cc1F)-c1ccccc1S(=O)(=O)NC(=O)OCCC(C)C)c1cccnc1 InChI=1S/C39H48FN5O6S/c1-6-12-36-42-33(8-3)38(34(46)19-22-44(37(47)13-7-2)30-14-11-21-41-25-30)45(36)26-29-18-17-28(24-32(29)40)31-15-9-10-16-35(31)52(49,50)43-39(48)51-23-20-27(4)5/h9-11,14-18,21,24-25,27H,6-8,12-13,19-20,22-23,26H2,1-5H3,(H,43,48) QBFKQSDMKSSMRE-UHFFFAOYSA-N 50032353 isopentyloxy 2-[2-(4-{4-ethyl-5-[3-[3-pyridyl(propyl)carboxamidopropanoyl]-2-propyl-1H-1-imidazolylmethyl}-3-fluorophenyl)phenylsulfonyl]caboxamido::N-{3-[5-Ethyl-3-(3-fluoro-2'-isopentyloxycarbonylsulfamoyl-biphenyl-4-ylmethyl)-2-propyl-3H-imidazol-4-yl]-3-oxo-propyl}-N-pyridin-3-yl-butyramide(XR510)::XR-510::CHEMBL100119 Type-2 angiotensin II receptor Rattus norvegicus 0.25 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032353 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032353&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 9896750 103940883 CHEMBL100119 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50049135 CCCc1nc(CC)c(C(=O)OC)n1Cc1ccc(cc1F)-c1ccccc1S(=O)(=O)NC(=O)OCCC(C)C InChI=1S/C29H36FN3O6S/c1-6-10-26-31-24(7-2)27(28(34)38-5)33(26)18-21-14-13-20(17-23(21)30)22-11-8-9-12-25(22)40(36,37)32-29(35)39-16-15-19(3)4/h8-9,11-14,17,19H,6-7,10,15-16,18H2,1-5H3,(H,32,35) PZLBCNBODYEVNF-UHFFFAOYSA-N 50032362 3-(2'-Isopentyloxycarbonylsulfamoyl-3-fluoro-biphenyl-4-ylmethyl)-5-ethyl-2-propyl-3H-imidazole-4-carboxylic acid methyl ester::isopentyloxy 2-{2-[3-flouoro-4-(4-ethyl-5-methyloxycarbonyl-2-propyl-1H-1-imidazolylmethyl)phenyl]phenylsulfonyl}carbonylamino::5-Ethyl-3-(3-fluoro-2'-isopentyloxycarbonylsulfamoyl-biphenyl-4-ylmethyl)-2-propyl-3H-imidazole-4-carboxylic acid methyl ester(EXP408)::CHEMBL294512 Type-2 angiotensin II receptor Rattus norvegicus 3 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032362 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032362&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 9851082 103940892 CHEMBL294512 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50049136 CCCC(=O)N(CCC(=O)c1c(CC)nc(CCC)n1Cc1ccc(cc1F)-c1ccccc1S(=O)(=O)NC(=O)OCCC(C)C)c1ccccc1 InChI=1S/C40H49FN4O6S/c1-6-14-37-42-34(8-3)39(35(46)22-24-44(38(47)15-7-2)31-16-10-9-11-17-31)45(37)27-30-21-20-29(26-33(30)41)32-18-12-13-19-36(32)52(49,50)43-40(48)51-25-23-28(4)5/h9-13,16-21,26,28H,6-8,14-15,22-25,27H2,1-5H3,(H,43,48) OPXPRIOZCSYEBY-UHFFFAOYSA-N 50032368 butyloxy 2-[2-(4-{4-ethyl-5-[3-phenyl(butyl)carboxamidopropanoyl]-2-propyl-1H-1-imidazolylmethyl}-3-fluorophenyl)phenylsulfonyl]caboxamido::CHEMBL98047 Type-2 angiotensin II receptor Rattus norvegicus 0.15 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032368 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032368&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 19430477 103940898 CHEMBL98047 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351 50049143 CCCCOC(=O)NS(=O)(=O)c1ccccc1-c1ccc(Cn2c(CCC)nc(CC)c2C(=O)OC)c(Cl)c1 InChI=1S/C28H34ClN3O6S/c1-5-8-16-38-28(34)31-39(35,36)24-13-10-9-12-21(24)19-14-15-20(22(29)17-19)18-32-25(11-6-2)30-23(7-3)26(32)27(33)37-4/h9-10,12-15,17H,5-8,11,16,18H2,1-4H3,(H,31,34) AWIVWBRKOUQKEI-UHFFFAOYSA-N 50032351 3-(2'-Butyloxycarbonylsulfamoyl-3-chloro-biphenyl-4-ylmethyl)-5-ethyl-2-propyl-3H-imidazole-4-carboxylic acid methyl ester::butyloxy 2-{2-[3-chloro-4-(4-ethyl-5-methyloxycarbonyl-2-propyl-1H-1-imidazolylmethyl)phenyl]phenylsulfonyl}carbonylamino::CHEMBL304022 Type-2 angiotensin II receptor Rattus norvegicus 7 ChEMBL 10.1021/jm00015a016 10.7270/Q2639NRN 7636854 Quan, ML; Chiu, AT; Ellis, CD; Wong, PC; Wexler, RR; Timmermans, PB 9/12/1995 11/10/2009 Dupont Pharmaceuticals http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50032351 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000274&target=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50032351&enzyme=Type-2+angiotensin+II+receptor&column=ki&startPg=0&Increment=50&submit=Search 9938088 103940881 CHEMBL304022 1 MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS Type-2 angiotensin II receptor AGTR2_RAT P35351