BindingDB Reactant_set_id Ligand SMILES Ligand InChI Ligand InChI Key BindingDB MonomerID BindingDB Ligand Name Target Name Target Source Organism According to Curator or DataSource Ki (nM) IC50 (nM) Kd (nM) EC50 (nM) kon (M-1-s-1) koff (s-1) pH Temp (C) Curation/DataSource Article DOI BindingDB Entry DOI PMID PubChem AID Patent Number Authors Date of publication Date in BindingDB Institution Link to Ligand in BindingDB Link to Target in BindingDB Link to Ligand-Target Pair in BindingDB Ligand HET ID in PDB PDB ID(s) for Ligand-Target Complex PubChem CID PubChem SID ChEBI ID of Ligand ChEMBL ID of Ligand DrugBank ID of Ligand IUPHAR_GRAC ID of Ligand KEGG ID of Ligand ZINC ID of Ligand Number of Protein Chains in Target (>1 implies a multichain complex) BindingDB Target Chain Sequence 1 PDB ID(s) of Target Chain 1 UniProt (SwissProt) Recommended Name of Target Chain 1 UniProt (SwissProt) Entry Name of Target Chain 1 UniProt (SwissProt) Primary ID of Target Chain 1 UniProt (SwissProt) Secondary ID(s) of Target Chain 1 UniProt (SwissProt) Alternative ID(s) of Target Chain 1 UniProt (TrEMBL) Submitted Name of Target Chain 1 UniProt (TrEMBL) Entry Name of Target Chain 1 UniProt (TrEMBL) Primary ID of Target Chain 1 UniProt (TrEMBL) Secondary ID(s) of Target Chain 1 UniProt (TrEMBL) Alternative ID(s) of Target Chain 1 BindingDB Target Chain Sequence 2 PDB ID(s) of Target Chain 2 UniProt (SwissProt) Recommended Name of Target Chain 2 UniProt (SwissProt) Entry Name of Target Chain 2 UniProt (SwissProt) Primary ID of Target Chain 2 UniProt (SwissProt) Secondary ID(s) of Target Chain 2 UniProt (SwissProt) Alternative ID(s) of Target Chain 2 UniProt (TrEMBL) Submitted Name of Target Chain 2 UniProt (TrEMBL) Entry Name of Target Chain 2 UniProt (TrEMBL) Primary ID of Target Chain 2 UniProt (TrEMBL) Secondary ID(s) of Target Chain 2 UniProt (TrEMBL) Alternative ID(s) of Target Chain 2 BindingDB Target Chain Sequence 3 PDB ID(s) of Target Chain 3 UniProt (SwissProt) Recommended Name of Target Chain 3 UniProt (SwissProt) Entry Name of Target Chain 3 UniProt (SwissProt) Primary ID of Target Chain 3 UniProt (SwissProt) Secondary ID(s) of Target Chain 3 UniProt (SwissProt) Alternative ID(s) of Target Chain 3 UniProt (TrEMBL) Submitted Name of Target Chain 3 UniProt (TrEMBL) Entry Name of Target Chain 3 UniProt (TrEMBL) Primary ID of Target Chain 3 UniProt (TrEMBL) Secondary ID(s) of Target Chain 3 UniProt (TrEMBL) Alternative ID(s) of Target Chain 3 BindingDB Target Chain Sequence 4 PDB ID(s) of Target Chain 4 UniProt (SwissProt) Recommended Name of Target Chain 4 UniProt (SwissProt) Entry Name of Target Chain 4 UniProt (SwissProt) Primary ID of Target Chain 4 UniProt (SwissProt) Secondary ID(s) of Target Chain 4 UniProt (SwissProt) Alternative ID(s) of Target Chain 4 UniProt (TrEMBL) Submitted Name of Target Chain 4 UniProt (TrEMBL) Entry Name of Target Chain 4 UniProt (TrEMBL) Primary ID of Target Chain 4 UniProt (TrEMBL) Secondary ID(s) of Target Chain 4 UniProt (TrEMBL) Alternative ID(s) of Target Chain 4 BindingDB Target Chain Sequence 5 PDB ID(s) of Target Chain 5 UniProt (SwissProt) Recommended Name of Target Chain 5 UniProt (SwissProt) Entry Name of Target Chain 5 UniProt (SwissProt) Primary ID of Target Chain 5 UniProt (SwissProt) Secondary ID(s) of Target Chain 5 UniProt (SwissProt) Alternative ID(s) of Target Chain 5 UniProt (TrEMBL) Submitted Name of Target Chain 5 UniProt (TrEMBL) Entry Name of Target Chain 5 UniProt (TrEMBL) Primary ID of Target Chain 5 UniProt (TrEMBL) Secondary ID(s) of Target Chain 5 UniProt (TrEMBL) Alternative ID(s) of Target Chain 5 BindingDB Target Chain Sequence 6 PDB ID(s) of Target Chain 6 UniProt (SwissProt) Recommended Name of Target Chain 6 UniProt (SwissProt) Entry Name of Target Chain 6 UniProt (SwissProt) Primary ID of Target Chain 6 UniProt (SwissProt) Secondary ID(s) of Target Chain 6 UniProt (SwissProt) Alternative ID(s) of Target Chain 6 UniProt (TrEMBL) Submitted Name of Target Chain 6 UniProt (TrEMBL) Entry Name of Target Chain 6 UniProt (TrEMBL) Primary ID of Target Chain 6 UniProt (TrEMBL) Secondary ID(s) of Target Chain 6 UniProt (TrEMBL) Alternative ID(s) of Target Chain 6 BindingDB Target Chain Sequence 7 PDB ID(s) of Target Chain 7 UniProt (SwissProt) Recommended Name of Target Chain 7 UniProt (SwissProt) Entry Name of Target Chain 7 UniProt (SwissProt) Primary ID of Target Chain 7 UniProt (SwissProt) Secondary ID(s) of Target Chain 7 UniProt (SwissProt) Alternative ID(s) of Target Chain 7 UniProt (TrEMBL) Submitted Name of Target Chain 7 UniProt (TrEMBL) Entry Name of Target Chain 7 UniProt (TrEMBL) Primary ID of Target Chain 7 UniProt (TrEMBL) Secondary ID(s) of Target Chain 7 UniProt (TrEMBL) Alternative ID(s) of Target Chain 7 BindingDB Target Chain Sequence 8 PDB ID(s) of Target Chain 8 UniProt (SwissProt) Recommended Name of Target Chain 8 UniProt (SwissProt) Entry Name of Target Chain 8 UniProt (SwissProt) Primary ID of Target Chain 8 UniProt (SwissProt) Secondary ID(s) of Target Chain 8 UniProt (SwissProt) Alternative ID(s) of Target Chain 8 UniProt (TrEMBL) Submitted Name of Target Chain 8 UniProt (TrEMBL) Entry Name of Target Chain 8 UniProt (TrEMBL) Primary ID of Target Chain 8 UniProt (TrEMBL) Secondary ID(s) of Target Chain 8 UniProt (TrEMBL) Alternative ID(s) of Target Chain 8 BindingDB Target Chain Sequence 9 PDB ID(s) of Target Chain 9 UniProt (SwissProt) Recommended Name of Target Chain 9 UniProt (SwissProt) Entry Name of Target Chain 9 UniProt (SwissProt) Primary ID of Target Chain 9 UniProt (SwissProt) Secondary ID(s) of Target Chain 9 UniProt (SwissProt) Alternative ID(s) of Target Chain 9 UniProt (TrEMBL) Submitted Name of Target Chain 9 UniProt (TrEMBL) Entry Name of Target Chain 9 UniProt (TrEMBL) Primary ID of Target Chain 9 UniProt (TrEMBL) Secondary ID(s) of Target Chain 9 UniProt (TrEMBL) Alternative ID(s) of Target Chain 9 BindingDB Target Chain Sequence 10 PDB ID(s) of Target Chain 10 UniProt (SwissProt) Recommended Name of Target Chain 10 UniProt (SwissProt) Entry Name of Target Chain 10 UniProt (SwissProt) Primary ID of Target Chain 10 UniProt (SwissProt) Secondary ID(s) of Target Chain 10 UniProt (SwissProt) Alternative ID(s) of Target Chain 10 UniProt (TrEMBL) Submitted Name of Target Chain 10 UniProt (TrEMBL) Entry Name of Target Chain 10 UniProt (TrEMBL) Primary ID of Target Chain 10 UniProt (TrEMBL) Secondary ID(s) of Target Chain 10 UniProt (TrEMBL) Alternative ID(s) of Target Chain 10 BindingDB Target Chain Sequence 11 PDB ID(s) of Target Chain 11 UniProt (SwissProt) Recommended Name of Target Chain 11 UniProt (SwissProt) Entry Name of Target Chain 11 UniProt (SwissProt) Primary ID of Target Chain 11 UniProt (SwissProt) Secondary ID(s) of Target Chain 11 UniProt (SwissProt) Alternative ID(s) of Target Chain 11 UniProt (TrEMBL) Submitted Name of Target Chain 11 UniProt (TrEMBL) Entry Name of Target Chain 11 UniProt (TrEMBL) Primary ID of Target Chain 11 UniProt (TrEMBL) Secondary ID(s) of Target Chain 11 UniProt (TrEMBL) Alternative ID(s) of Target Chain 11 BindingDB Target Chain Sequence 12 PDB ID(s) of Target Chain 12 UniProt (SwissProt) Recommended Name of Target Chain 12 UniProt (SwissProt) Entry Name of Target Chain 12 UniProt (SwissProt) Primary ID of Target Chain 12 UniProt (SwissProt) Secondary ID(s) of Target Chain 12 UniProt (SwissProt) Alternative ID(s) of Target Chain 12 UniProt (TrEMBL) Submitted Name of Target Chain 12 UniProt (TrEMBL) Entry Name of Target Chain 12 UniProt (TrEMBL) Primary ID of Target Chain 12 UniProt (TrEMBL) Secondary ID(s) of Target Chain 12 UniProt (TrEMBL) Alternative ID(s) of Target Chain 12 BindingDB Target Chain Sequence 13 PDB ID(s) of Target Chain 13 UniProt (SwissProt) Recommended Name of Target Chain 13 UniProt (SwissProt) Entry Name of Target Chain 13 UniProt (SwissProt) Primary ID of Target Chain 13 UniProt (SwissProt) Secondary ID(s) of Target Chain 13 UniProt (SwissProt) Alternative ID(s) of Target Chain 13 UniProt (TrEMBL) Submitted Name of Target Chain 13 UniProt (TrEMBL) Entry Name of Target Chain 13 UniProt (TrEMBL) Primary ID of Target Chain 13 UniProt (TrEMBL) Secondary ID(s) of Target Chain 13 UniProt (TrEMBL) Alternative ID(s) of Target Chain 13 BindingDB Target Chain Sequence 14 PDB ID(s) of Target Chain 14 UniProt (SwissProt) Recommended Name of Target Chain 14 UniProt (SwissProt) Entry Name of Target Chain 14 UniProt (SwissProt) Primary ID of Target Chain 14 UniProt (SwissProt) Secondary ID(s) of Target Chain 14 UniProt (SwissProt) Alternative ID(s) of Target Chain 14 UniProt (TrEMBL) Submitted Name of Target Chain 14 UniProt (TrEMBL) Entry Name of Target Chain 14 UniProt (TrEMBL) Primary ID of Target Chain 14 UniProt (TrEMBL) Secondary ID(s) of Target Chain 14 UniProt (TrEMBL) Alternative ID(s) of Target Chain 14 BindingDB Target Chain Sequence 15 PDB ID(s) of Target Chain 15 UniProt (SwissProt) Recommended Name of Target Chain 15 UniProt (SwissProt) Entry Name of Target Chain 15 UniProt (SwissProt) Primary ID of Target Chain 15 UniProt (SwissProt) Secondary ID(s) of Target Chain 15 UniProt (SwissProt) Alternative ID(s) of Target Chain 15 UniProt (TrEMBL) Submitted Name of Target Chain 15 UniProt (TrEMBL) Entry Name of Target Chain 15 UniProt (TrEMBL) Primary ID of Target Chain 15 UniProt (TrEMBL) Secondary ID(s) of Target Chain 15 UniProt (TrEMBL) Alternative ID(s) of Target Chain 15 BindingDB Target Chain Sequence 16 PDB ID(s) of Target Chain 16 UniProt (SwissProt) Recommended Name of Target Chain 16 UniProt (SwissProt) Entry Name of Target Chain 16 UniProt (SwissProt) Primary ID of Target Chain 16 UniProt (SwissProt) Secondary ID(s) of Target Chain 16 UniProt (SwissProt) Alternative ID(s) of Target Chain 16 UniProt (TrEMBL) Submitted Name of Target Chain 16 UniProt (TrEMBL) Entry Name of Target Chain 16 UniProt (TrEMBL) Primary ID of Target Chain 16 UniProt (TrEMBL) Secondary ID(s) of Target Chain 16 UniProt (TrEMBL) Alternative ID(s) of Target Chain 16 BindingDB Target Chain Sequence 17 PDB ID(s) of Target Chain 17 UniProt (SwissProt) Recommended Name of Target Chain 17 UniProt (SwissProt) Entry Name of Target Chain 17 UniProt (SwissProt) Primary ID of Target Chain 17 UniProt (SwissProt) Secondary ID(s) of Target Chain 17 UniProt (SwissProt) Alternative ID(s) of Target Chain 17 UniProt (TrEMBL) Submitted Name of Target Chain 17 UniProt (TrEMBL) Entry Name of Target Chain 17 UniProt (TrEMBL) Primary ID of Target Chain 17 UniProt (TrEMBL) Secondary ID(s) of Target Chain 17 UniProt (TrEMBL) Alternative ID(s) of Target Chain 17 BindingDB Target Chain Sequence 18 PDB ID(s) of Target Chain 18 UniProt (SwissProt) Recommended Name of Target Chain 18 UniProt (SwissProt) Entry Name of Target Chain 18 UniProt (SwissProt) Primary ID of Target Chain 18 UniProt (SwissProt) Secondary ID(s) of Target Chain 18 UniProt (SwissProt) Alternative ID(s) of Target Chain 18 UniProt (TrEMBL) Submitted Name of Target Chain 18 UniProt (TrEMBL) Entry Name of Target Chain 18 UniProt (TrEMBL) Primary ID of Target Chain 18 UniProt (TrEMBL) Secondary ID(s) of Target Chain 18 UniProt (TrEMBL) Alternative ID(s) of Target Chain 18 BindingDB Target Chain Sequence 19 PDB ID(s) of Target Chain 19 UniProt (SwissProt) Recommended Name of Target Chain 19 UniProt (SwissProt) Entry Name of Target Chain 19 UniProt (SwissProt) Primary ID of Target Chain 19 UniProt (SwissProt) Secondary ID(s) of Target Chain 19 UniProt (SwissProt) Alternative ID(s) of Target Chain 19 UniProt (TrEMBL) Submitted Name of Target Chain 19 UniProt (TrEMBL) Entry Name of Target Chain 19 UniProt (TrEMBL) Primary ID of Target Chain 19 UniProt (TrEMBL) Secondary ID(s) of Target Chain 19 UniProt (TrEMBL) Alternative ID(s) of Target Chain 19 BindingDB Target Chain Sequence 20 PDB ID(s) of Target Chain 20 UniProt (SwissProt) Recommended Name of Target Chain 20 UniProt (SwissProt) Entry Name of Target Chain 20 UniProt (SwissProt) Primary ID of Target Chain 20 UniProt (SwissProt) Secondary ID(s) of Target Chain 20 UniProt (SwissProt) Alternative ID(s) of Target Chain 20 UniProt (TrEMBL) Submitted Name of Target Chain 20 UniProt (TrEMBL) Entry Name of Target Chain 20 UniProt (TrEMBL) Primary ID of Target Chain 20 UniProt (TrEMBL) Secondary ID(s) of Target Chain 20 UniProt (TrEMBL) Alternative ID(s) of Target Chain 20 BindingDB Target Chain Sequence 21 PDB ID(s) of Target Chain 21 UniProt (SwissProt) Recommended Name of Target Chain 21 UniProt (SwissProt) Entry Name of Target Chain 21 UniProt (SwissProt) Primary ID of Target Chain 21 UniProt (SwissProt) Secondary ID(s) of Target Chain 21 UniProt (SwissProt) Alternative ID(s) of Target Chain 21 UniProt (TrEMBL) Submitted Name of Target Chain 21 UniProt (TrEMBL) Entry Name of Target Chain 21 UniProt (TrEMBL) Primary ID of Target Chain 21 UniProt (TrEMBL) Secondary ID(s) of Target Chain 21 UniProt (TrEMBL) Alternative ID(s) of Target Chain 21 BindingDB Target Chain Sequence 22 PDB ID(s) of Target Chain 22 UniProt (SwissProt) Recommended Name of Target Chain 22 UniProt (SwissProt) Entry Name of Target Chain 22 UniProt (SwissProt) Primary ID of Target Chain 22 UniProt (SwissProt) Secondary ID(s) of Target Chain 22 UniProt (SwissProt) Alternative ID(s) of Target Chain 22 UniProt (TrEMBL) Submitted Name of Target Chain 22 UniProt (TrEMBL) Entry Name of Target Chain 22 UniProt (TrEMBL) Primary ID of Target Chain 22 UniProt (TrEMBL) Secondary ID(s) of Target Chain 22 UniProt (TrEMBL) Alternative ID(s) of Target Chain 22 BindingDB Target Chain Sequence 23 PDB ID(s) of Target Chain 23 UniProt (SwissProt) Recommended Name of Target Chain 23 UniProt (SwissProt) Entry Name of Target Chain 23 UniProt (SwissProt) Primary ID of Target Chain 23 UniProt (SwissProt) Secondary ID(s) of Target Chain 23 UniProt (SwissProt) Alternative ID(s) of Target Chain 23 UniProt (TrEMBL) Submitted Name of Target Chain 23 UniProt (TrEMBL) Entry Name of Target Chain 23 UniProt (TrEMBL) Primary ID of Target Chain 23 UniProt (TrEMBL) Secondary ID(s) of Target Chain 23 UniProt (TrEMBL) Alternative ID(s) of Target Chain 23 BindingDB Target Chain Sequence 24 PDB ID(s) of Target Chain 24 UniProt (SwissProt) Recommended Name of Target Chain 24 UniProt (SwissProt) Entry Name of Target Chain 24 UniProt (SwissProt) Primary ID of Target Chain 24 UniProt (SwissProt) Secondary ID(s) of Target Chain 24 UniProt (SwissProt) Alternative ID(s) of Target Chain 24 UniProt (TrEMBL) Submitted Name of Target Chain 24 UniProt (TrEMBL) Entry Name of Target Chain 24 UniProt (TrEMBL) Primary ID of Target Chain 24 UniProt (TrEMBL) Secondary ID(s) of Target Chain 24 UniProt (TrEMBL) Alternative ID(s) of Target Chain 24 BindingDB Target Chain Sequence 25 PDB ID(s) of Target Chain 25 UniProt (SwissProt) Recommended Name of Target Chain 25 UniProt (SwissProt) Entry Name of Target Chain 25 UniProt (SwissProt) Primary ID of Target Chain 25 UniProt (SwissProt) Secondary ID(s) of Target Chain 25 UniProt (SwissProt) Alternative ID(s) of Target Chain 25 UniProt (TrEMBL) Submitted Name of Target Chain 25 UniProt (TrEMBL) Entry Name of Target Chain 25 UniProt (TrEMBL) Primary ID of Target Chain 25 UniProt (TrEMBL) Secondary ID(s) of Target Chain 25 UniProt (TrEMBL) Alternative ID(s) of Target Chain 25 BindingDB Target Chain Sequence 26 PDB ID(s) of Target Chain 26 UniProt (SwissProt) Recommended Name of Target Chain 26 UniProt (SwissProt) Entry Name of Target Chain 26 UniProt (SwissProt) Primary ID of Target Chain 26 UniProt (SwissProt) Secondary ID(s) of Target Chain 26 UniProt (SwissProt) Alternative ID(s) of Target Chain 26 UniProt (TrEMBL) Submitted Name of Target Chain 26 UniProt (TrEMBL) Entry Name of Target Chain 26 UniProt (TrEMBL) Primary ID of Target Chain 26 UniProt (TrEMBL) Secondary ID(s) of Target Chain 26 UniProt (TrEMBL) Alternative ID(s) of Target Chain 26 BindingDB Target Chain Sequence 27 PDB ID(s) of Target Chain 27 UniProt (SwissProt) Recommended Name of Target Chain 27 UniProt (SwissProt) Entry Name of Target Chain 27 UniProt (SwissProt) Primary ID of Target Chain 27 UniProt (SwissProt) Secondary ID(s) of Target Chain 27 UniProt (SwissProt) Alternative ID(s) of Target Chain 27 UniProt (TrEMBL) Submitted Name of Target Chain 27 UniProt (TrEMBL) Entry Name of Target Chain 27 UniProt (TrEMBL) Primary ID of Target Chain 27 UniProt (TrEMBL) Secondary ID(s) of Target Chain 27 UniProt (TrEMBL) Alternative ID(s) of Target Chain 27 BindingDB Target Chain Sequence 28 PDB ID(s) of Target Chain 28 UniProt (SwissProt) Recommended Name of Target Chain 28 UniProt (SwissProt) Entry Name of Target Chain 28 UniProt (SwissProt) Primary ID of Target Chain 28 UniProt (SwissProt) Secondary ID(s) of Target Chain 28 UniProt (SwissProt) Alternative ID(s) of Target Chain 28 UniProt (TrEMBL) Submitted Name of Target Chain 28 UniProt (TrEMBL) Entry Name of Target Chain 28 UniProt (TrEMBL) Primary ID of Target Chain 28 UniProt (TrEMBL) Secondary ID(s) of Target Chain 28 UniProt (TrEMBL) Alternative ID(s) of Target Chain 28 BindingDB Target Chain Sequence 29 PDB ID(s) of Target Chain 29 UniProt (SwissProt) Recommended Name of Target Chain 29 UniProt (SwissProt) Entry Name of Target Chain 29 UniProt (SwissProt) Primary ID of Target Chain 29 UniProt (SwissProt) Secondary ID(s) of Target Chain 29 UniProt (SwissProt) Alternative ID(s) of Target Chain 29 UniProt (TrEMBL) Submitted Name of Target Chain 29 UniProt (TrEMBL) Entry Name of Target Chain 29 UniProt (TrEMBL) Primary ID of Target Chain 29 UniProt (TrEMBL) Secondary ID(s) of Target Chain 29 UniProt (TrEMBL) Alternative ID(s) of Target Chain 29 BindingDB Target Chain Sequence 30 PDB ID(s) of Target Chain 30 UniProt (SwissProt) Recommended Name of Target Chain 30 UniProt (SwissProt) Entry Name of Target Chain 30 UniProt (SwissProt) Primary ID of Target Chain 30 UniProt (SwissProt) Secondary ID(s) of Target Chain 30 UniProt (SwissProt) Alternative ID(s) of Target Chain 30 UniProt (TrEMBL) Submitted Name of Target Chain 30 UniProt (TrEMBL) Entry Name of Target Chain 30 UniProt (TrEMBL) Primary ID of Target Chain 30 UniProt (TrEMBL) Secondary ID(s) of Target Chain 30 UniProt (TrEMBL) Alternative ID(s) of Target Chain 30 BindingDB Target Chain Sequence 31 PDB ID(s) of Target Chain 31 UniProt (SwissProt) Recommended Name of Target Chain 31 UniProt (SwissProt) Entry Name of Target Chain 31 UniProt (SwissProt) Primary ID of Target Chain 31 UniProt (SwissProt) Secondary ID(s) of Target Chain 31 UniProt (SwissProt) Alternative ID(s) of Target Chain 31 UniProt (TrEMBL) Submitted Name of Target Chain 31 UniProt (TrEMBL) Entry Name of Target Chain 31 UniProt (TrEMBL) Primary ID of Target Chain 31 UniProt (TrEMBL) Secondary ID(s) of Target Chain 31 UniProt (TrEMBL) Alternative ID(s) of Target Chain 31 BindingDB Target Chain Sequence 32 PDB ID(s) of Target Chain 32 UniProt (SwissProt) Recommended Name of Target Chain 32 UniProt (SwissProt) Entry Name of Target Chain 32 UniProt (SwissProt) Primary ID of Target Chain 32 UniProt (SwissProt) Secondary ID(s) of Target Chain 32 UniProt (SwissProt) Alternative ID(s) of Target Chain 32 UniProt (TrEMBL) Submitted Name of Target Chain 32 UniProt (TrEMBL) Entry Name of Target Chain 32 UniProt (TrEMBL) Primary ID of Target Chain 32 UniProt (TrEMBL) Secondary ID(s) of Target Chain 32 UniProt (TrEMBL) Alternative ID(s) of Target Chain 32 BindingDB Target Chain Sequence 33 PDB ID(s) of Target Chain 33 UniProt (SwissProt) Recommended Name of Target Chain 33 UniProt (SwissProt) Entry Name of Target Chain 33 UniProt (SwissProt) Primary ID of Target Chain 33 UniProt (SwissProt) Secondary ID(s) of Target Chain 33 UniProt (SwissProt) Alternative ID(s) of Target Chain 33 UniProt (TrEMBL) Submitted Name of Target Chain 33 UniProt (TrEMBL) Entry Name of Target Chain 33 UniProt (TrEMBL) Primary ID of Target Chain 33 UniProt (TrEMBL) Secondary ID(s) of Target Chain 33 UniProt (TrEMBL) Alternative ID(s) of Target Chain 33 BindingDB Target Chain Sequence 34 PDB ID(s) of Target Chain 34 UniProt (SwissProt) Recommended Name of Target Chain 34 UniProt (SwissProt) Entry Name of Target Chain 34 UniProt (SwissProt) Primary ID of Target Chain 34 UniProt (SwissProt) Secondary ID(s) of Target Chain 34 UniProt (SwissProt) Alternative ID(s) of Target Chain 34 UniProt (TrEMBL) Submitted Name of Target Chain 34 UniProt (TrEMBL) Entry Name of Target Chain 34 UniProt (TrEMBL) Primary ID of Target Chain 34 UniProt (TrEMBL) Secondary ID(s) of Target Chain 34 UniProt (TrEMBL) Alternative ID(s) of Target Chain 34 BindingDB Target Chain Sequence 35 PDB ID(s) of Target Chain 35 UniProt (SwissProt) Recommended Name of Target Chain 35 UniProt (SwissProt) Entry Name of Target Chain 35 UniProt (SwissProt) Primary ID of Target Chain 35 UniProt (SwissProt) Secondary ID(s) of Target Chain 35 UniProt (SwissProt) Alternative ID(s) of Target Chain 35 UniProt (TrEMBL) Submitted Name of Target Chain 35 UniProt (TrEMBL) Entry Name of Target Chain 35 UniProt (TrEMBL) Primary ID of Target Chain 35 UniProt (TrEMBL) Secondary ID(s) of Target Chain 35 UniProt (TrEMBL) Alternative ID(s) of Target Chain 35 BindingDB Target Chain Sequence 36 PDB ID(s) of Target Chain 36 UniProt (SwissProt) Recommended Name of Target Chain 36 UniProt (SwissProt) Entry Name of Target Chain 36 UniProt (SwissProt) Primary ID of Target Chain 36 UniProt (SwissProt) Secondary ID(s) of Target Chain 36 UniProt (SwissProt) Alternative ID(s) of Target Chain 36 UniProt (TrEMBL) Submitted Name of Target Chain 36 UniProt (TrEMBL) Entry Name of Target Chain 36 UniProt (TrEMBL) Primary ID of Target Chain 36 UniProt (TrEMBL) Secondary ID(s) of Target Chain 36 UniProt (TrEMBL) Alternative ID(s) of Target Chain 36 BindingDB Target Chain Sequence 37 PDB ID(s) of Target Chain 37 UniProt (SwissProt) Recommended Name of Target Chain 37 UniProt (SwissProt) Entry Name of Target Chain 37 UniProt (SwissProt) Primary ID of Target Chain 37 UniProt (SwissProt) Secondary ID(s) of Target Chain 37 UniProt (SwissProt) Alternative ID(s) of Target Chain 37 UniProt (TrEMBL) Submitted Name of Target Chain 37 UniProt (TrEMBL) Entry Name of Target Chain 37 UniProt (TrEMBL) Primary ID of Target Chain 37 UniProt (TrEMBL) Secondary ID(s) of Target Chain 37 UniProt (TrEMBL) Alternative ID(s) of Target Chain 37 BindingDB Target Chain Sequence 38 PDB ID(s) of Target Chain 38 UniProt (SwissProt) Recommended Name of Target Chain 38 UniProt (SwissProt) Entry Name of Target Chain 38 UniProt (SwissProt) Primary ID of Target Chain 38 UniProt (SwissProt) Secondary ID(s) of Target Chain 38 UniProt (SwissProt) Alternative ID(s) of Target Chain 38 UniProt (TrEMBL) Submitted Name of Target Chain 38 UniProt (TrEMBL) Entry Name of Target Chain 38 UniProt (TrEMBL) Primary ID of Target Chain 38 UniProt (TrEMBL) Secondary ID(s) of Target Chain 38 UniProt (TrEMBL) Alternative ID(s) of Target Chain 38 BindingDB Target Chain Sequence 39 PDB ID(s) of Target Chain 39 UniProt (SwissProt) Recommended Name of Target Chain 39 UniProt (SwissProt) Entry Name of Target Chain 39 UniProt (SwissProt) Primary ID of Target Chain 39 UniProt (SwissProt) Secondary ID(s) of Target Chain 39 UniProt (SwissProt) Alternative ID(s) of Target Chain 39 UniProt (TrEMBL) Submitted Name of Target Chain 39 UniProt (TrEMBL) Entry Name of Target Chain 39 UniProt (TrEMBL) Primary ID of Target Chain 39 UniProt (TrEMBL) Secondary ID(s) of Target Chain 39 UniProt (TrEMBL) Alternative ID(s) of Target Chain 39 BindingDB Target Chain Sequence 40 PDB ID(s) of Target Chain 40 UniProt (SwissProt) Recommended Name of Target Chain 40 UniProt (SwissProt) Entry Name of Target Chain 40 UniProt (SwissProt) Primary ID of Target Chain 40 UniProt (SwissProt) Secondary ID(s) of Target Chain 40 UniProt (SwissProt) Alternative ID(s) of Target Chain 40 UniProt (TrEMBL) Submitted Name of Target Chain 40 UniProt (TrEMBL) Entry Name of Target Chain 40 UniProt (TrEMBL) Primary ID of Target Chain 40 UniProt (TrEMBL) Secondary ID(s) of Target Chain 40 UniProt (TrEMBL) Alternative ID(s) of Target Chain 40 BindingDB Target Chain Sequence 41 PDB ID(s) of Target Chain 41 UniProt (SwissProt) Recommended Name of Target Chain 41 UniProt (SwissProt) Entry Name of Target Chain 41 UniProt (SwissProt) Primary ID of Target Chain 41 UniProt (SwissProt) Secondary ID(s) of Target Chain 41 UniProt (SwissProt) Alternative ID(s) of Target Chain 41 UniProt (TrEMBL) Submitted Name of Target Chain 41 UniProt (TrEMBL) Entry Name of Target Chain 41 UniProt (TrEMBL) Primary ID of Target Chain 41 UniProt (TrEMBL) Secondary ID(s) of Target Chain 41 UniProt (TrEMBL) Alternative ID(s) of Target Chain 41 BindingDB Target Chain Sequence 42 PDB ID(s) of Target Chain 42 UniProt (SwissProt) Recommended Name of Target Chain 42 UniProt (SwissProt) Entry Name of Target Chain 42 UniProt (SwissProt) Primary ID of Target Chain 42 UniProt (SwissProt) Secondary ID(s) of Target Chain 42 UniProt (SwissProt) Alternative ID(s) of Target Chain 42 UniProt (TrEMBL) Submitted Name of Target Chain 42 UniProt (TrEMBL) Entry Name of Target Chain 42 UniProt (TrEMBL) Primary ID of Target Chain 42 UniProt (TrEMBL) Secondary ID(s) of Target Chain 42 UniProt (TrEMBL) Alternative ID(s) of Target Chain 42 BindingDB Target Chain Sequence 43 PDB ID(s) of Target Chain 43 UniProt (SwissProt) Recommended Name of Target Chain 43 UniProt (SwissProt) Entry Name of Target Chain 43 UniProt (SwissProt) Primary ID of Target Chain 43 UniProt (SwissProt) Secondary ID(s) of Target Chain 43 UniProt (SwissProt) Alternative ID(s) of Target Chain 43 UniProt (TrEMBL) Submitted Name of Target Chain 43 UniProt (TrEMBL) Entry Name of Target Chain 43 UniProt (TrEMBL) Primary ID of Target Chain 43 UniProt (TrEMBL) Secondary ID(s) of Target Chain 43 UniProt (TrEMBL) Alternative ID(s) of Target Chain 43 BindingDB Target Chain Sequence 44 PDB ID(s) of Target Chain 44 UniProt (SwissProt) Recommended Name of Target Chain 44 UniProt (SwissProt) Entry Name of Target Chain 44 UniProt (SwissProt) Primary ID of Target Chain 44 UniProt (SwissProt) Secondary ID(s) of Target Chain 44 UniProt (SwissProt) Alternative ID(s) of Target Chain 44 UniProt (TrEMBL) Submitted Name of Target Chain 44 UniProt (TrEMBL) Entry Name of Target Chain 44 UniProt (TrEMBL) Primary ID of Target Chain 44 UniProt (TrEMBL) Secondary ID(s) of Target Chain 44 UniProt (TrEMBL) Alternative ID(s) of Target Chain 44 BindingDB Target Chain Sequence 45 PDB ID(s) of Target Chain 45 UniProt (SwissProt) Recommended Name of Target Chain 45 UniProt (SwissProt) Entry Name of Target Chain 45 UniProt (SwissProt) Primary ID of Target Chain 45 UniProt (SwissProt) Secondary ID(s) of Target Chain 45 UniProt (SwissProt) Alternative ID(s) of Target Chain 45 UniProt (TrEMBL) Submitted Name of Target Chain 45 UniProt (TrEMBL) Entry Name of Target Chain 45 UniProt (TrEMBL) Primary ID of Target Chain 45 UniProt (TrEMBL) Secondary ID(s) of Target Chain 45 UniProt (TrEMBL) Alternative ID(s) of Target Chain 45 BindingDB Target Chain Sequence 46 PDB ID(s) of Target Chain 46 UniProt (SwissProt) Recommended Name of Target Chain 46 UniProt (SwissProt) Entry Name of Target Chain 46 UniProt (SwissProt) Primary ID of Target Chain 46 UniProt (SwissProt) Secondary ID(s) of Target Chain 46 UniProt (SwissProt) Alternative ID(s) of Target Chain 46 UniProt (TrEMBL) Submitted Name of Target Chain 46 UniProt (TrEMBL) Entry Name of Target Chain 46 UniProt (TrEMBL) Primary ID of Target Chain 46 UniProt (TrEMBL) Secondary ID(s) of Target Chain 46 UniProt (TrEMBL) Alternative ID(s) of Target Chain 46 BindingDB Target Chain Sequence 47 PDB ID(s) of Target Chain 47 UniProt (SwissProt) Recommended Name of Target Chain 47 UniProt (SwissProt) Entry Name of Target Chain 47 UniProt (SwissProt) Primary ID of Target Chain 47 UniProt (SwissProt) Secondary ID(s) of Target Chain 47 UniProt (SwissProt) Alternative ID(s) of Target Chain 47 UniProt (TrEMBL) Submitted Name of Target Chain 47 UniProt (TrEMBL) Entry Name of Target Chain 47 UniProt (TrEMBL) Primary ID of Target Chain 47 UniProt (TrEMBL) Secondary ID(s) of Target Chain 47 UniProt (TrEMBL) Alternative ID(s) of Target Chain 47 BindingDB Target Chain Sequence 48 PDB ID(s) of Target Chain 48 UniProt (SwissProt) Recommended Name of Target Chain 48 UniProt (SwissProt) Entry Name of Target Chain 48 UniProt (SwissProt) Primary ID of Target Chain 48 UniProt (SwissProt) Secondary ID(s) of Target Chain 48 UniProt (SwissProt) Alternative ID(s) of Target Chain 48 UniProt (TrEMBL) Submitted Name of Target Chain 48 UniProt (TrEMBL) Entry Name of Target Chain 48 UniProt (TrEMBL) Primary ID of Target Chain 48 UniProt (TrEMBL) Secondary ID(s) of Target Chain 48 UniProt (TrEMBL) Alternative ID(s) of Target Chain 48 BindingDB Target Chain Sequence 49 PDB ID(s) of Target Chain 49 UniProt (SwissProt) Recommended Name of Target Chain 49 UniProt (SwissProt) Entry Name of Target Chain 49 UniProt (SwissProt) Primary ID of Target Chain 49 UniProt (SwissProt) Secondary ID(s) of Target Chain 49 UniProt (SwissProt) Alternative ID(s) of Target Chain 49 UniProt (TrEMBL) Submitted Name of Target Chain 49 UniProt (TrEMBL) Entry Name of Target Chain 49 UniProt (TrEMBL) Primary ID of Target Chain 49 UniProt (TrEMBL) Secondary ID(s) of Target Chain 49 UniProt (TrEMBL) Alternative ID(s) of Target Chain 49 BindingDB Target Chain Sequence 50 PDB ID(s) of Target Chain 50 UniProt (SwissProt) Recommended Name of Target Chain 50 UniProt (SwissProt) Entry Name of Target Chain 50 UniProt (SwissProt) Primary ID of Target Chain 50 UniProt (SwissProt) Secondary ID(s) of Target Chain 50 UniProt (SwissProt) Alternative ID(s) of Target Chain 50 UniProt (TrEMBL) Submitted Name of Target Chain 50 UniProt (TrEMBL) Entry Name of Target Chain 50 UniProt (TrEMBL) Primary ID of Target Chain 50 UniProt (TrEMBL) Secondary ID(s) of Target Chain 50 UniProt (TrEMBL) Alternative ID(s) of Target Chain 50 50001794 OC(=O)CCCCc1sccc1CCCc1ccccc1 InChI=1S/C18H22O2S/c19-18(20)12-5-4-11-17-16(13-14-21-17)10-6-9-15-7-2-1-3-8-15/h1-3,7-8,13-14H,4-6,9-12H2,(H,19,20) CDZNJLGNDBFKBZ-UHFFFAOYSA-N 50001144 CHEMBL108094::5-[3-(3-Phenyl-propyl)-thiophen-2-yl]-pentanoic acid Leukotriene B4 receptor 1 Homo sapiens 3500 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001144 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001144&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666601 103915636 CHEMBL108094 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001795 OC(=O)CCCCCCc1ccsc1CCCc1ccc(Cl)cc1 InChI=1S/C20H25ClO2S/c21-18-12-10-16(11-13-18)6-5-8-19-17(14-15-24-19)7-3-1-2-4-9-20(22)23/h10-15H,1-9H2,(H,22,23) IARBAADDPALBIU-UHFFFAOYSA-N 50001145 CHEMBL107760::7-{2-[3-(4-Chloro-phenyl)-propyl]-thiophen-3-yl}-heptanoic acid Leukotriene B4 receptor 1 Homo sapiens 1000 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001145 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001145&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666579 103915637 CHEMBL107760 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001796 OC(=O)CCCCCc1sccc1CCCc1ccccc1 InChI=1S/C19H24O2S/c20-19(21)13-6-2-5-12-18-17(14-15-22-18)11-7-10-16-8-3-1-4-9-16/h1,3-4,8-9,14-15H,2,5-7,10-13H2,(H,20,21) OGNITMNPJVRJDB-UHFFFAOYSA-N 50001146 CHEMBL109016::6-[3-(3-Phenyl-propyl)-thiophen-2-yl]-hexanoic acid Leukotriene B4 receptor 1 Homo sapiens 4500 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001146 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001146&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666610 103915638 CHEMBL109016 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001797 OC(=O)CCCCCCc1sc(cc1CCCc1ccccc1)-c1ccccc1 InChI=1S/C26H30O2S/c27-26(28)19-10-2-1-9-18-24-23(17-11-14-21-12-5-3-6-13-21)20-25(29-24)22-15-7-4-8-16-22/h3-8,12-13,15-16,20H,1-2,9-11,14,17-19H2,(H,27,28) QBLCUCHXZZLQRO-UHFFFAOYSA-N 50001147 CHEMBL110707::7-[5-Phenyl-3-(3-phenyl-propyl)-thiophen-2-yl]-heptanoic acid Leukotriene B4 receptor 1 Homo sapiens 1000 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001147 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001147&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666621 103915639 CHEMBL110707 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001798 OC(=O)CCCCCCc1csc(CCc2ccccc2)c1 InChI=1S/C19H24O2S/c20-19(21)11-7-2-1-4-10-17-14-18(22-15-17)13-12-16-8-5-3-6-9-16/h3,5-6,8-9,14-15H,1-2,4,7,10-13H2,(H,20,21) CXDJEXHSQMPXCU-UHFFFAOYSA-N 50001148 CHEMBL106055::7-(5-Phenethyl-thiophen-3-yl)-heptanoic acid Leukotriene B4 receptor 1 Homo sapiens 10000 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001148 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001148&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666575 103915640 CHEMBL106055 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001799 OC(CCCCCC(O)=O)c1sccc1CCCc1ccccc1 InChI=1S/C20H26O3S/c21-18(12-5-2-6-13-19(22)23)20-17(14-15-24-20)11-7-10-16-8-3-1-4-9-16/h1,3-4,8-9,14-15,18,21H,2,5-7,10-13H2,(H,22,23) XOYPBJNDYVGTKE-UHFFFAOYSA-N 50001150 CHEMBL109128::7-Hydroxy-7-[3-(3-phenyl-propyl)-thiophen-2-yl]-heptanoic acid Leukotriene B4 receptor 1 Homo sapiens 6000 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001150 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001150&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666631 103915642 CHEMBL109128 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001800 OC(=O)CCCCCCc1csc(Cc2ccccc2)c1 InChI=1S/C18H22O2S/c19-18(20)11-7-2-1-4-10-16-13-17(21-14-16)12-15-8-5-3-6-9-15/h3,5-6,8-9,13-14H,1-2,4,7,10-12H2,(H,19,20) RDNCXIQCSAIULH-UHFFFAOYSA-N 50001149 CHEMBL322290::7-(5-Benzyl-thiophen-3-yl)-heptanoic acid Leukotriene B4 receptor 1 Homo sapiens 10000 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001149 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001149&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666597 103915641 CHEMBL322290 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001801 CC(CCCCCc1sccc1CCCc1ccccc1)C(O)=O InChI=1S/C21H28O2S/c1-17(21(22)23)9-4-2-7-14-20-19(15-16-24-20)13-8-12-18-10-5-3-6-11-18/h3,5-6,10-11,15-17H,2,4,7-9,12-14H2,1H3,(H,22,23) OWOZZOGNCPJVLM-UHFFFAOYSA-N 50001151 CHEMBL110767::2-Methyl-7-[3-(3-phenyl-propyl)-thiophen-2-yl]-heptanoic acid Leukotriene B4 receptor 1 Homo sapiens 110 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001151 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001151&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666618 103915643 CHEMBL110767 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001802 CC(CCCCCc1cc(C)sc1CCCc1ccccc1)C(O)=O InChI=1S/C22H30O2S/c1-17(22(23)24)10-5-3-8-14-20-16-18(2)25-21(20)15-9-13-19-11-6-4-7-12-19/h4,6-7,11-12,16-17H,3,5,8-10,13-15H2,1-2H3,(H,23,24) QQHQXMPVQNNKSK-UHFFFAOYSA-N 50001152 CHEMBL265563::2-Methyl-7-[5-methyl-2-(3-phenyl-propyl)-thiophen-3-yl]-heptanoic acid Leukotriene B4 receptor 1 Homo sapiens 300 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001152 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001152&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666588 103915644 CHEMBL265563 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001803 OC(=O)CCCCCCc1sccc1CCCc1ccccc1 InChI=1S/C20H26O2S/c21-20(22)14-7-2-1-6-13-19-18(15-16-23-19)12-8-11-17-9-4-3-5-10-17/h3-5,9-10,15-16H,1-2,6-8,11-14H2,(H,21,22) WSDYSQYMVNCBGT-UHFFFAOYSA-N 50001153 CHEMBL109176::7-[3-(3-Phenyl-propyl)-thiophen-2-yl]-heptanoic acid Leukotriene B4 receptor 1 Homo sapiens 1000 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001153 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001153&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666603 103915645 CHEMBL109176 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001804 Cc1cc(CCCc2ccccc2)c(CCCCCCC(O)=O)s1 InChI=1S/C21H28O2S/c1-17-16-19(13-9-12-18-10-5-4-6-11-18)20(24-17)14-7-2-3-8-15-21(22)23/h4-6,10-11,16H,2-3,7-9,12-15H2,1H3,(H,22,23) KLFUWYTYDFTCPX-UHFFFAOYSA-N 50001156 CHEMBL110708::7-[5-Methyl-3-(3-phenyl-propyl)-thiophen-2-yl]-heptanoic acid Leukotriene B4 receptor 1 Homo sapiens 1500 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001156 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001156&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666613 103915648 CHEMBL110708 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001805 COc1ccc(CCCc2sccc2CCCCCCC(O)=O)cc1 InChI=1S/C21H28O3S/c1-24-19-13-11-17(12-14-19)7-6-9-20-18(15-16-25-20)8-4-2-3-5-10-21(22)23/h11-16H,2-10H2,1H3,(H,22,23) WXOLUMLTFMPBIS-UHFFFAOYSA-N 50001155 CHEMBL326000::7-{2-[3-(4-Methoxy-phenyl)-propyl]-thiophen-3-yl}-heptanoic acid Leukotriene B4 receptor 1 Homo sapiens 3000 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001155 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001155&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666582 103915647 CHEMBL326000 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001806 Cc1cc(CCCc2ccccc2)c(SCCCCCC(O)=O)s1 InChI=1S/C20H26O2S2/c1-16-15-18(12-8-11-17-9-4-2-5-10-17)20(24-16)23-14-7-3-6-13-19(21)22/h2,4-5,9-10,15H,3,6-8,11-14H2,1H3,(H,21,22) WPQLUYYETFQJBF-UHFFFAOYSA-N 50001154 CHEMBL109129::6-[5-Methyl-3-(3-phenyl-propyl)-thiophen-2-ylsulfanyl]-hexanoic acid Leukotriene B4 receptor 1 Homo sapiens 3000 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001154 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001154&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666630 103915646 CHEMBL109129 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001807 OC(=O)CCCCCCc1csc(CCCc2ccc(Cl)cc2)c1 InChI=1S/C20H25ClO2S/c21-18-12-10-16(11-13-18)7-5-8-19-14-17(15-24-19)6-3-1-2-4-9-20(22)23/h10-15H,1-9H2,(H,22,23) FKMBIKUSMNUQPZ-UHFFFAOYSA-N 50001158 CHEMBL109015::7-{5-[3-(4-Chloro-phenyl)-propyl]-thiophen-3-yl}-heptanoic acid Leukotriene B4 receptor 1 Homo sapiens 1000 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001158 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001158&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666578 103915649 CHEMBL109015 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001808 Cc1cc(CCCc2ccccc2)c(CCCCCC(C)(C)C(O)=O)s1 InChI=1S/C23H32O2S/c1-18-17-20(14-10-13-19-11-6-4-7-12-19)21(26-18)15-8-5-9-16-23(2,3)22(24)25/h4,6-7,11-12,17H,5,8-10,13-16H2,1-3H3,(H,24,25) XUGZZPICKDLWKX-UHFFFAOYSA-N 50001159 CHEMBL110243::2,2-Dimethyl-7-[5-methyl-3-(3-phenyl-propyl)-thiophen-2-yl]-heptanoic acid Leukotriene B4 receptor 1 Homo sapiens 200 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001159 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001159&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666615 103915650 CHEMBL110243 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001809 OC(=O)CCCCCCc1ccsc1CCCc1ccccc1 InChI=1S/C20H26O2S/c21-20(22)14-7-2-1-6-12-18-15-16-23-19(18)13-8-11-17-9-4-3-5-10-17/h3-5,9-10,15-16H,1-2,6-8,11-14H2,(H,21,22) QZWPFJDJIUNWMQ-UHFFFAOYSA-N 50001160 CHEMBL110402::7-[2-(3-Phenyl-propyl)-thiophen-3-yl]-heptanoic acid Leukotriene B4 receptor 1 Homo sapiens 1000 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001160 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001160&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666577 103915651 CHEMBL110402 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001810 CC(C)(CCCCCc1sccc1CCCc1ccccc1)C(O)=O InChI=1S/C22H30O2S/c1-22(2,21(23)24)16-8-4-7-14-20-19(15-17-25-20)13-9-12-18-10-5-3-6-11-18/h3,5-6,10-11,15,17H,4,7-9,12-14,16H2,1-2H3,(H,23,24) QMXLXSYXJOJQSN-UHFFFAOYSA-N 50001162 CHEMBL108415::2,2-Dimethyl-7-[3-(3-phenyl-propyl)-thiophen-2-yl]-heptanoic acid Leukotriene B4 receptor 1 Homo sapiens 60 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001162 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001162&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 132425 103915653 CHEMBL108415 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001811 CC(CCCCCc1sc(C)cc1CCCc1ccccc1)C(O)=O InChI=1S/C22H30O2S/c1-17(22(23)24)10-5-3-8-15-21-20(16-18(2)25-21)14-9-13-19-11-6-4-7-12-19/h4,6-7,11-12,16-17H,3,5,8-10,13-15H2,1-2H3,(H,23,24) XHWVSVODLQKTPR-UHFFFAOYSA-N 50001161 CHEMBL326650::2-Methyl-7-[5-methyl-3-(3-phenyl-propyl)-thiophen-2-yl]-heptanoic acid Leukotriene B4 receptor 1 Homo sapiens 300 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001161 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001161&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666614 103915652 CHEMBL326650 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001812 CC(C)(CCCCCc1cc(sc1CCCc1ccccc1)-c1ccccc1)C(O)=O InChI=1S/C28H34O2S/c1-28(2,27(29)30)20-11-5-10-18-24-21-26(23-16-8-4-9-17-23)31-25(24)19-12-15-22-13-6-3-7-14-22/h3-4,6-9,13-14,16-17,21H,5,10-12,15,18-20H2,1-2H3,(H,29,30) GVIHRIFMDICCIS-UHFFFAOYSA-N 50001164 CHEMBL322985::2,2-Dimethyl-7-[5-phenyl-2-(3-phenyl-propyl)-thiophen-3-yl]-heptanoic acid Leukotriene B4 receptor 1 Homo sapiens 1200 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001164 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001164&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 44337707 103915654 CHEMBL322985 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001813 CC(C)(CCCCCc1sc(cc1CCCc1ccccc1)-c1ccccc1)C(O)=O InChI=1S/C28H34O2S/c1-28(2,27(29)30)20-11-5-10-19-25-24(18-12-15-22-13-6-3-7-14-22)21-26(31-25)23-16-8-4-9-17-23/h3-4,6-9,13-14,16-17,21H,5,10-12,15,18-20H2,1-2H3,(H,29,30) KCPVSOFACKEMON-UHFFFAOYSA-N 50001165 CHEMBL430520::2,2-Dimethyl-7-[5-phenyl-3-(3-phenyl-propyl)-thiophen-2-yl]-heptanoic acid Leukotriene B4 receptor 1 Homo sapiens 800 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001165 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001165&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666623 103915655 CHEMBL430520 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001814 Cc1cc(CCCCCCC(O)=O)c(CCCc2ccccc2)s1 InChI=1S/C21H28O2S/c1-17-16-19(13-7-2-3-8-15-21(22)23)20(24-17)14-9-12-18-10-5-4-6-11-18/h4-6,10-11,16H,2-3,7-9,12-15H2,1H3,(H,22,23) KXFOGJGKRSYONJ-UHFFFAOYSA-N 50001166 CHEMBL320258::7-[5-Methyl-2-(3-phenyl-propyl)-thiophen-3-yl]-heptanoic acid Leukotriene B4 receptor 1 Homo sapiens 700 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001166 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001166&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666586 103915656 CHEMBL320258 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5 50001815 OC(=O)CCCCCCc1csc(CCCc2ccc(O)cc2)c1 InChI=1S/C20H26O3S/c21-18-12-10-16(11-13-18)7-5-8-19-14-17(15-24-19)6-3-1-2-4-9-20(22)23/h10-15,21H,1-9H2,(H,22,23) AMKKYYBUIIENSF-UHFFFAOYSA-N 50001167 CHEMBL107781::7-{5-[3-(4-Hydroxy-phenyl)-propyl]-thiophen-3-yl}-heptanoic acid Leukotriene B4 receptor 1 Homo sapiens 5000 ChEMBL 10.1021/jm00095a011 10.7270/Q2WH2NZ1 1324316 Labaudiniere, R; Hilboll, G; Leon-Lomeli, A; Terlain, B; Cavy, F; Parnham, M; Kuhl, P; Dereu, N 9/22/1992 11/10/2009 Centre De Recherche De Vitry-Alfortville http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=50001167 http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=49000702&target=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search http://www.bindingdb.org/rwd/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=50001167&enzyme=Leukotriene+B4+receptor+1&column=ki&startPg=0&Increment=50&submit=Search 15666581 103915657 CHEMBL107781 1 MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN Leukotriene B4 receptor 1 LT4R1_HUMAN Q15722 Q13305 Q53XV5 Q92641 Q9BSU5